Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3621
Gene name
Locationscaffold_286:12192..13624
Strand-
Gene length (bp)1432
Transcript length (bp)1374
Coding sequence length (bp)1371
Protein length (aa) 457

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11309 DUF3112 Protein of unknown function (DUF3112) 8.7E-06 256 316

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

Domain # Start End Length
1 69 88 19
2 101 123 22
3 133 155 22
4 181 203 22
5 218 240 22
6 257 279 22
7 294 313 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3621
METLRQSSLSLPTLREPETTADPSTTASFFCTTIREASAPSSTAGCTEQATNPLNGPFFGGVPTSTDDGLVTFIF
LLLFALGAVLHLVRLIGNNQRRHKFLLSIPLVAFCLFRTFYCIFRFAWAFLRPPFFNQAVVALAMAMEAYGSVIL
IPNLFISQRIICAMHPVVGWHKLFQTATWCLAMSIAPVSIIASVSSIIKIVAFRTTSAQMTKQVLEFADSWQLMV
SLIPLVSIFIACAVPGQRPQNFGTGNLRLKTALLVFSSITLVIAPAVRLAVVANPQAALDGSPISGKPVFYTTAL
FLESLTVFSYLIFRFDNLYWIPDGSKGPGDYSQAPKDSNRSSETEWTREQIKLEVSKLGIQHEFLNSGEKNPQSP
LYTLLFPSSEDENGFSENHAVGGSASAGPSTPSTFQRWTPPPQDVEKSIQRLSIDQKMITEWSHRRTSSWDSVDE
AKMFAFI
Coding >Ophio5|3621
ATGGAAACCTTGAGGCAATCATCACTCTCCCTTCCCACGTTGAGAGAACCAGAGACAACAGCGGATCCGTCGACG
ACGGCGAGTTTTTTCTGCACCACCATCAGGGAGGCTTCCGCCCCCAGTTCCACGGCCGGATGCACAGAGCAGGCG
ACGAATCCGCTCAACGGGCCATTCTTCGGAGGCGTTCCGACTTCCACCGACGATGGACTCGTTACCTTTATCTTT
CTTCTCCTCTTTGCTTTGGGTGCTGTCCTCCACCTCGTTCGATTGATAGGCAACAATCAGCGTCGTCATAAGTTT
CTTCTCTCGATACCCCTCGTCGCCTTTTGCCTCTTTAGGACTTTTTACTGCATCTTTCGCTTCGCCTGGGCCTTT
CTTCGGCCGCCTTTTTTTAATCAGGCGGTTGTCGCGTTGGCGATGGCCATGGAGGCCTACGGCTCCGTCATCTTG
ATTCCTAACCTGTTCATCAGCCAGCGTATCATTTGCGCCATGCATCCTGTTGTCGGCTGGCATAAGCTCTTCCAA
ACTGCAACCTGGTGTTTGGCCATGAGCATCGCTCCGGTCTCCATCATCGCCAGCGTTTCCTCCATCATCAAGATT
GTCGCATTCAGGACGACTTCTGCCCAGATGACCAAGCAAGTTCTCGAATTTGCCGATTCATGGCAGCTTATGGTT
TCCCTTATTCCTCTCGTCAGTATCTTCATCGCTTGCGCTGTGCCAGGGCAGCGTCCTCAGAACTTCGGCACCGGG
AATCTCCGGCTCAAGACTGCCTTGCTAGTCTTTAGCTCCATCACTCTGGTCATTGCCCCAGCCGTGAGGCTCGCG
GTGGTGGCAAATCCCCAGGCAGCACTTGACGGATCGCCCATCTCTGGCAAGCCCGTCTTTTACACGACTGCCCTC
TTTTTGGAGTCTCTTACCGTTTTCTCATACCTCATATTCCGTTTCGACAACCTGTACTGGATACCCGACGGTTCC
AAGGGCCCCGGCGACTACTCACAGGCTCCGAAGGACTCGAACAGGTCTTCTGAAACCGAATGGACACGAGAGCAG
ATTAAGCTTGAAGTCAGCAAGTTGGGCATTCAACACGAATTCCTCAACTCGGGTGAGAAAAATCCGCAGTCGCCG
TTGTACACTCTGCTCTTCCCATCCTCTGAAGACGAAAACGGATTTTCTGAGAATCACGCGGTGGGAGGATCGGCA
TCAGCCGGGCCGTCTACACCCTCGACCTTCCAACGATGGACACCGCCGCCGCAAGATGTCGAAAAATCTATCCAA
AGGTTGAGCATTGACCAGAAGATGATCACGGAGTGGTCGCATAGACGCACTTCTAGCTGGGATTCCGTGGATGAG
GCAAAGATGTTTGCCTTTATT
Transcript >Ophio5|3621
ATGGAAACCTTGAGGCAATCATCACTCTCCCTTCCCACGTTGAGAGAACCAGAGACAACAGCGGATCCGTCGACG
ACGGCGAGTTTTTTCTGCACCACCATCAGGGAGGCTTCCGCCCCCAGTTCCACGGCCGGATGCACAGAGCAGGCG
ACGAATCCGCTCAACGGGCCATTCTTCGGAGGCGTTCCGACTTCCACCGACGATGGACTCGTTACCTTTATCTTT
CTTCTCCTCTTTGCTTTGGGTGCTGTCCTCCACCTCGTTCGATTGATAGGCAACAATCAGCGTCGTCATAAGTTT
CTTCTCTCGATACCCCTCGTCGCCTTTTGCCTCTTTAGGACTTTTTACTGCATCTTTCGCTTCGCCTGGGCCTTT
CTTCGGCCGCCTTTTTTTAATCAGGCGGTTGTCGCGTTGGCGATGGCCATGGAGGCCTACGGCTCCGTCATCTTG
ATTCCTAACCTGTTCATCAGCCAGCGTATCATTTGCGCCATGCATCCTGTTGTCGGCTGGCATAAGCTCTTCCAA
ACTGCAACCTGGTGTTTGGCCATGAGCATCGCTCCGGTCTCCATCATCGCCAGCGTTTCCTCCATCATCAAGATT
GTCGCATTCAGGACGACTTCTGCCCAGATGACCAAGCAAGTTCTCGAATTTGCCGATTCATGGCAGCTTATGGTT
TCCCTTATTCCTCTCGTCAGTATCTTCATCGCTTGCGCTGTGCCAGGGCAGCGTCCTCAGAACTTCGGCACCGGG
AATCTCCGGCTCAAGACTGCCTTGCTAGTCTTTAGCTCCATCACTCTGGTCATTGCCCCAGCCGTGAGGCTCGCG
GTGGTGGCAAATCCCCAGGCAGCACTTGACGGATCGCCCATCTCTGGCAAGCCCGTCTTTTACACGACTGCCCTC
TTTTTGGAGTCTCTTACCGTTTTCTCATACCTCATATTCCGTTTCGACAACCTGTACTGGATACCCGACGGTTCC
AAGGGCCCCGGCGACTACTCACAGGCTCCGAAGGACTCGAACAGGTCTTCTGAAACCGAATGGACACGAGAGCAG
ATTAAGCTTGAAGTCAGCAAGTTGGGCATTCAACACGAATTCCTCAACTCGGGTGAGAAAAATCCGCAGTCGCCG
TTGTACACTCTGCTCTTCCCATCCTCTGAAGACGAAAACGGATTTTCTGAGAATCACGCGGTGGGAGGATCGGCA
TCAGCCGGGCCGTCTACACCCTCGACCTTCCAACGATGGACACCGCCGCCGCAAGATGTCGAAAAATCTATCCAA
AGGTTGAGCATTGACCAGAAGATGATCACGGAGTGGTCGCATAGACGCACTTCTAGCTGGGATTCCGTGGATGAG
GCAAAGATGTTTGCCTTTATTTAA
Gene >Ophio5|3621
ATGGAAACCTTGAGGCAATCATCACTCTCCCTTCCCACGTTGAGAGAACCAGAGACAACAGCGGATCCGTCGACG
ACGGCGAGTTTTTTCTGCACCACCATCAGGGAGGCTTCCGCCCCCAGTTCCACGGCCGGATGCACAGAGCAGGCG
ACGAATCCGCTCAACGGGCCATTCTTCGGAGGCGTTCCGACTTCCACCGACGATGGACTCGTTACCTTTATCTTT
CTTCTCCTCTTTGCTTTGGGTGCTGTCCTCCACCTCGTTCGATTGATAGGCAACAATCAGCGTCGTCATAAGTTT
CTTCTCTCGATACCCCTCGTCGCCTTTTGCCTCTTTAGGACTTTTTACTGCATCTTTCGCTTCGCCTGGGCCTTT
CTTCGGCCGCCTTTTTTTAATCAGGCGGTTGTCGCGTTGGCGATGGCCATGGAGGCCTACGGGTTTGTCCTCTCC
TGTCTGCCAGCCGGTCTTTTGAGCTGACGGTGAATATTGTCCCAGCTCCGTCATCTTGATTCCTAACCTGTTCAT
CAGCCAGCGTATCATTTGCGCCATGCATCCTGTTGTCGGCTGGCATAAGCTCTTCCAAACTGCAACCTGGTGTTT
GGCCATGAGCATCGCTCCGGTCTCCATCATCGCCAGCGTTTCCTCCATCATCAAGATTGTCGCATTCAGGACGAC
TTCTGCCCAGATGACCAAGCAAGTTCTCGAATTTGCCGATTCATGGCAGCTTATGGTTTCCCTTATTCCTCTCGT
CAGTATCTTCATCGCTTGCGCTGTGCCAGGGCAGCGTCCTCAGAACTTCGGCACCGGGAATCTCCGGCTCAAGAC
TGCCTTGCTAGTCTTTAGCTCCATCACTCTGGTCATTGCCCCAGCCGTGAGGCTCGCGGTGGTGGCAAATCCCCA
GGCAGCACTTGACGGATCGCCCATCTCTGGCAAGCCCGTCTTTTACACGACTGCCCTCTTTTTGGAGTCTCTTAC
CGTTTTCTCATACCTCATATTCCGTTTCGACAACCTGTACTGGATACCCGACGGTTCCAAGGGCCCCGGCGACTA
CTCACAGGCTCCGAAGGACTCGAACAGGTCTTCTGAAACCGAATGGACACGAGAGCAGATTAAGCTTGAAGTCAG
CAAGTTGGGCATTCAACACGAATTCCTCAACTCGGGTGAGAAAAATCCGCAGTCGCCGTTGTACACTCTGCTCTT
CCCATCCTCTGAAGACGAAAACGGATTTTCTGAGAATCACGCGGTGGGAGGATCGGCATCAGCCGGGCCGTCTAC
ACCCTCGACCTTCCAACGATGGACACCGCCGCCGCAAGATGTCGAAAAATCTATCCAAAGGTTGAGCATTGACCA
GAAGATGATCACGGAGTGGTCGCATAGACGCACTTCTAGCTGGGATTCCGTGGATGAGGCAAAGATGTTTGCCTT
TATTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail