Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|360
Gene name
Locationscaffold_1083:752..2617
Strand-
Gene length (bp)1865
Transcript length (bp)1662
Coding sequence length (bp)1659
Protein length (aa) 553

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01565 FAD_binding_4 FAD binding domain 8.4E-24 115 250

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D7UQ40|SOL5_ALTSO Bifunctional solanapyrone synthase OS=Alternaria solani GN=sol5 PE=1 SV=1 80 553 1.0E-48
sp|D4B1P2|A2372_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02372 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02372 PE=1 SV=1 56 553 2.0E-44
sp|P08159|HDNO_ARTOX 6-hydroxy-D-nicotine oxidase OS=Arthrobacter oxydans PE=1 SV=2 81 281 3.0E-18
sp|P43485|MCRA_STRLA Mitomycin radical oxidase OS=Streptomyces lavendulae GN=mcrA PE=1 SV=2 109 308 1.0E-15
sp|Q796Y5|YGAK_BACSU Uncharacterized FAD-linked oxidoreductase YgaK OS=Bacillus subtilis (strain 168) GN=ygaK PE=3 SV=4 112 282 5.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D7UQ40|SOL5_ALTSO Bifunctional solanapyrone synthase OS=Alternaria solani GN=sol5 PE=1 SV=1 80 553 1.0E-48
sp|D4B1P2|A2372_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02372 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02372 PE=1 SV=1 56 553 2.0E-44
sp|P08159|HDNO_ARTOX 6-hydroxy-D-nicotine oxidase OS=Arthrobacter oxydans PE=1 SV=2 81 281 3.0E-18
sp|P43485|MCRA_STRLA Mitomycin radical oxidase OS=Streptomyces lavendulae GN=mcrA PE=1 SV=2 109 308 1.0E-15
sp|Q796Y5|YGAK_BACSU Uncharacterized FAD-linked oxidoreductase YgaK OS=Bacillus subtilis (strain 168) GN=ygaK PE=3 SV=4 112 282 5.0E-13
sp|Q9FUJ3|CKX2_ARATH Cytokinin dehydrogenase 2 OS=Arabidopsis thaliana GN=CKX2 PE=1 SV=2 57 343 1.0E-12
sp|D4B1Z7|A2478_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02478 PE=1 SV=1 180 283 8.0E-12
sp|O22213|CKX1_ARATH Cytokinin dehydrogenase 1 OS=Arabidopsis thaliana GN=CKX1 PE=1 SV=1 103 310 2.0E-11
sp|Q54H55|Y8969_DICDI FAD-linked oxidoreductase DDB_G0289697 OS=Dictyostelium discoideum GN=DDB_G0289697 PE=2 SV=1 83 310 2.0E-11
sp|Q8GTB6|THCAS_CANSA Tetrahydrocannabinolic acid synthase OS=Cannabis sativa PE=1 SV=1 73 316 3.0E-11
sp|O06997|YVDP_BACSU Uncharacterized FAD-linked oxidoreductase YvdP OS=Bacillus subtilis (strain 168) GN=yvdP PE=1 SV=1 84 279 2.0E-09
sp|Q5Z620|CKX10_ORYSJ Cytokinin dehydrogenase 10 OS=Oryza sativa subsp. japonica GN=CKX10 PE=3 SV=1 115 302 7.0E-09
sp|A6P6V9|CBDAS_CANSA Cannabidiolic acid synthase OS=Cannabis sativa GN=CBDAS PE=1 SV=1 73 288 7.0E-09
sp|A6P6W0|CASL1_CANSA Cannabidiolic acid synthase-like 1 OS=Cannabis sativa GN=CBDAS2 PE=2 SV=1 61 273 1.0E-08
sp|A6P6W1|CASL2_CANSA Cannabidiolic acid synthase-like 2 OS=Cannabis sativa GN=CBDAS3 PE=2 SV=1 61 273 3.0E-08
sp|Q75K78|CKX9_ORYSJ Cytokinin dehydrogenase 9 OS=Oryza sativa subsp. japonica GN=CKX9 PE=2 SV=1 115 316 3.0E-08
sp|Q33DQ2|THCAI_CANSA Inactive tetrahydrocannabinolic acid synthase OS=Cannabis sativa PE=3 SV=1 73 279 4.0E-08
sp|P58710|GGLO_MOUSE L-gulonolactone oxidase OS=Mus musculus GN=Gulo PE=1 SV=3 115 304 5.0E-08
sp|Q9LTS3|CKX3_ARATH Cytokinin dehydrogenase 3 OS=Arabidopsis thaliana GN=CKX3 PE=1 SV=1 111 287 5.0E-08
sp|D4AS41|A7056_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07056 PE=1 SV=2 122 263 6.0E-08
sp|Q5JLP4|CKX4_ORYSJ Cytokinin dehydrogenase 4 OS=Oryza sativa subsp. japonica GN=CKX4 PE=2 SV=1 115 316 1.0E-07
sp|Q6YW51|CKX6_ORYSJ Cytokinin dehydrogenase 6 OS=Oryza sativa subsp. japonica GN=CKX6 PE=3 SV=1 109 287 1.0E-07
sp|Q9FUJ2|CKX4_ARATH Cytokinin dehydrogenase 4 OS=Arabidopsis thaliana GN=CKX4 PE=1 SV=2 114 275 3.0E-07
sp|Q6YW50|CKX7_ORYSJ Cytokinin dehydrogenase 7 OS=Oryza sativa subsp. japonica GN=CKX7 PE=3 SV=1 109 282 3.0E-07
sp|Q9LY71|CKX6_ARATH Cytokinin dehydrogenase 6 OS=Arabidopsis thaliana GN=CKX6 PE=2 SV=2 85 287 5.0E-07
sp|Q7SGY1|ALO_NEUCR Putative D-arabinono-1,4-lactone oxidase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=alo-1 PE=3 SV=1 115 291 8.0E-07
sp|Q67YU0|CKX5_ARATH Cytokinin dehydrogenase 5 OS=Arabidopsis thaliana GN=CKX5 PE=2 SV=1 115 373 2.0E-06
sp|A3AVP1|CKX8_ORYSJ Cytokinin dehydrogenase 8 OS=Oryza sativa subsp. japonica GN=CKX8 PE=3 SV=1 177 275 2.0E-06
sp|A2XVN3|CKX8_ORYSI Cytokinin dehydrogenase 8 OS=Oryza sativa subsp. indica GN=CKX8 PE=3 SV=1 177 275 2.0E-06
sp|P10867|GGLO_RAT L-gulonolactone oxidase OS=Rattus norvegicus GN=Gulo PE=1 SV=3 115 304 5.0E-06
sp|Q9FZC8|FOX5_ARATH Flavin-dependent oxidoreductase FOX5 OS=Arabidopsis thaliana GN=FOX5 PE=3 SV=1 70 273 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0036094 small molecule binding No
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0000166 nucleotide binding No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0043167 ion binding No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.2668 0.1104 0.7993 0.0881 0.0985 0.0875 0.3446 0.4017 0.1881 0.0339

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
AA7 3.7E-59 103 299

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup23
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1466
Ophiocordyceps australis 1348a (Ghana) OphauG2|2796
Ophiocordyceps australis map64 (Brazil) OphauB2|3994
Ophiocordyceps australis map64 (Brazil) OphauB2|591
Ophiocordyceps australis map64 (Brazil) OphauB2|6458
Ophiocordyceps camponoti-floridani Ophcf2|06420
Ophiocordyceps camponoti-floridani Ophcf2|02533
Ophiocordyceps camponoti-floridani Ophcf2|04590
Ophiocordyceps camponoti-floridani Ophcf2|06808
Ophiocordyceps camponoti-rufipedis Ophun1|3755
Ophiocordyceps camponoti-rufipedis Ophun1|2002
Ophiocordyceps camponoti-rufipedis Ophun1|1119
Ophiocordyceps camponoti-rufipedis Ophun1|7502
Ophiocordyceps camponoti-rufipedis Ophun1|4159
Ophiocordyceps kimflemingae Ophio5|2066
Ophiocordyceps kimflemingae Ophio5|3352
Ophiocordyceps kimflemingae Ophio5|360 (this protein)
Ophiocordyceps kimflemingae Ophio5|4122
Ophiocordyceps kimflemingae Ophio5|5606
Ophiocordyceps subramaniannii Hirsu2|7822
Ophiocordyceps subramaniannii Hirsu2|6429
Ophiocordyceps subramaniannii Hirsu2|16
Ophiocordyceps subramaniannii Hirsu2|10639

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|360
MCQINSIQYRKCRYCGLAGSSFSKDFAMVDLSPHRSKAKYTPNAVKLSKWRTALEMMATVFVAIVLLAVTASPND
SADPCLALSQALPGTVNLPNSTLYQAENRYWSTRQAEVHPQCFVAPRTALEVSQTVKLLTSLRTPFSVKSGGHTA
FEGGSNNHNGVTIDLVNLNEITISEDRGTVSVGAGNRWINVSRVLDNQGLAVVGGRAADVGVGGLILGGGISFFS
GTRGWACDNVRNYEIVVSSGQVVNASPSVNPDLYWALRGGGGSNFGIVTRFDLEAFPQGDLWASSIVFPGSLNRT
IVSLFTDFSSRGFIEDPSAHSYLVMGYQQLAGHFFVLTSFFHPEPLPENAVPSVFLPFHSVPGGMPATNGTHLAK
VSTLSMAIDQPSGSRQTWWDTSVHVKSSKLFEDIVSLFAAYVQDLLVSAGTAGFFTPFLVFQPISPGVIQAMQKN
GGNALGLIPDDGPLMIVQLAIAWNDEGLDSQVEKSSAALIQQINELAKEKGLYRGFLYMNYAGKDQDVFAGYGNQ
SHGRLKATAASWDPNRVFQHLWRGYFKL
Coding >Ophio5|360
ATGTGCCAAATCAATTCAATCCAGTACAGAAAATGCCGCTACTGTGGCCTTGCAGGCTCGTCCTTTTCGAAAGAC
TTCGCCATGGTTGATTTATCCCCACACCGATCCAAGGCCAAGTATACCCCGAACGCAGTCAAGCTCTCGAAGTGG
AGGACGGCGTTGGAGATGATGGCGACGGTTTTTGTAGCCATCGTCCTGTTAGCTGTAACAGCCAGTCCGAATGAT
TCTGCAGACCCCTGCCTTGCCTTATCCCAAGCCTTGCCGGGGACAGTCAATCTACCCAATTCGACTCTTTACCAG
GCAGAGAACAGGTACTGGTCCACACGACAAGCAGAAGTGCATCCACAGTGCTTCGTAGCCCCGCGGACCGCCTTG
GAGGTTTCCCAAACCGTCAAATTACTCACATCACTCAGAACCCCCTTTTCTGTCAAATCCGGTGGTCACACTGCC
TTTGAGGGGGGCTCCAATAACCACAACGGCGTCACCATAGATTTAGTCAACCTCAACGAAATTACCATTTCGGAG
GATCGCGGAACCGTCTCTGTAGGGGCTGGAAACCGATGGATCAATGTGTCCCGGGTTCTTGACAACCAGGGCTTG
GCTGTTGTTGGCGGCAGAGCTGCGGATGTCGGCGTGGGCGGCCTCATCCTTGGCGGTGGCATCTCCTTCTTCTCC
GGAACTCGAGGTTGGGCCTGCGACAACGTCCGCAACTACGAGATCGTCGTTTCCTCCGGCCAAGTTGTCAACGCT
TCGCCGTCGGTGAACCCTGATTTGTACTGGGCCCTTCGCGGTGGCGGGGGCTCCAATTTCGGAATCGTCACTCGC
TTCGACCTTGAAGCCTTCCCTCAGGGCGATTTATGGGCGAGCTCCATCGTCTTCCCTGGCTCCCTCAATAGGACC
ATCGTCTCACTCTTTACAGACTTCAGCAGTAGAGGCTTTATTGAAGACCCGTCGGCCCATTCCTATCTAGTCATG
GGTTATCAGCAGCTCGCTGGACACTTCTTCGTCCTCACGAGCTTCTTCCATCCCGAGCCGTTGCCAGAAAACGCC
GTGCCGTCCGTTTTCCTCCCTTTTCACTCTGTTCCTGGCGGCATGCCGGCCACCAACGGCACACACCTGGCAAAG
GTCTCAACGCTATCTATGGCTATCGACCAGCCCTCCGGCTCCCGCCAGACGTGGTGGGACACGTCTGTCCACGTG
AAGTCGTCGAAACTATTTGAAGACATCGTTTCTCTCTTTGCAGCTTACGTCCAAGACCTCCTTGTTTCCGCGGGA
ACAGCCGGTTTTTTCACACCCTTCTTGGTCTTTCAGCCGATATCTCCAGGCGTCATTCAGGCCATGCAAAAGAAT
GGCGGCAATGCACTTGGCTTAATACCCGACGATGGGCCGCTCATGATTGTACAGTTGGCAATTGCTTGGAACGAT
GAAGGGCTGGATTCACAAGTCGAAAAGTCCTCGGCAGCCCTGATTCAGCAGATTAATGAACTTGCCAAAGAAAAG
GGGCTATACCGTGGCTTTCTCTACATGAACTACGCCGGAAAAGACCAAGACGTCTTTGCGGGCTACGGAAATCAG
AGTCATGGCCGATTAAAGGCAACCGCCGCGAGTTGGGACCCCAACCGTGTTTTTCAACATCTGTGGAGAGGTTAT
TTTAAGCTG
Transcript >Ophio5|360
ATGTGCCAAATCAATTCAATCCAGTACAGAAAATGCCGCTACTGTGGCCTTGCAGGCTCGTCCTTTTCGAAAGAC
TTCGCCATGGTTGATTTATCCCCACACCGATCCAAGGCCAAGTATACCCCGAACGCAGTCAAGCTCTCGAAGTGG
AGGACGGCGTTGGAGATGATGGCGACGGTTTTTGTAGCCATCGTCCTGTTAGCTGTAACAGCCAGTCCGAATGAT
TCTGCAGACCCCTGCCTTGCCTTATCCCAAGCCTTGCCGGGGACAGTCAATCTACCCAATTCGACTCTTTACCAG
GCAGAGAACAGGTACTGGTCCACACGACAAGCAGAAGTGCATCCACAGTGCTTCGTAGCCCCGCGGACCGCCTTG
GAGGTTTCCCAAACCGTCAAATTACTCACATCACTCAGAACCCCCTTTTCTGTCAAATCCGGTGGTCACACTGCC
TTTGAGGGGGGCTCCAATAACCACAACGGCGTCACCATAGATTTAGTCAACCTCAACGAAATTACCATTTCGGAG
GATCGCGGAACCGTCTCTGTAGGGGCTGGAAACCGATGGATCAATGTGTCCCGGGTTCTTGACAACCAGGGCTTG
GCTGTTGTTGGCGGCAGAGCTGCGGATGTCGGCGTGGGCGGCCTCATCCTTGGCGGTGGCATCTCCTTCTTCTCC
GGAACTCGAGGTTGGGCCTGCGACAACGTCCGCAACTACGAGATCGTCGTTTCCTCCGGCCAAGTTGTCAACGCT
TCGCCGTCGGTGAACCCTGATTTGTACTGGGCCCTTCGCGGTGGCGGGGGCTCCAATTTCGGAATCGTCACTCGC
TTCGACCTTGAAGCCTTCCCTCAGGGCGATTTATGGGCGAGCTCCATCGTCTTCCCTGGCTCCCTCAATAGGACC
ATCGTCTCACTCTTTACAGACTTCAGCAGTAGAGGCTTTATTGAAGACCCGTCGGCCCATTCCTATCTAGTCATG
GGTTATCAGCAGCTCGCTGGACACTTCTTCGTCCTCACGAGCTTCTTCCATCCCGAGCCGTTGCCAGAAAACGCC
GTGCCGTCCGTTTTCCTCCCTTTTCACTCTGTTCCTGGCGGCATGCCGGCCACCAACGGCACACACCTGGCAAAG
GTCTCAACGCTATCTATGGCTATCGACCAGCCCTCCGGCTCCCGCCAGACGTGGTGGGACACGTCTGTCCACGTG
AAGTCGTCGAAACTATTTGAAGACATCGTTTCTCTCTTTGCAGCTTACGTCCAAGACCTCCTTGTTTCCGCGGGA
ACAGCCGGTTTTTTCACACCCTTCTTGGTCTTTCAGCCGATATCTCCAGGCGTCATTCAGGCCATGCAAAAGAAT
GGCGGCAATGCACTTGGCTTAATACCCGACGATGGGCCGCTCATGATTGTACAGTTGGCAATTGCTTGGAACGAT
GAAGGGCTGGATTCACAAGTCGAAAAGTCCTCGGCAGCCCTGATTCAGCAGATTAATGAACTTGCCAAAGAAAAG
GGGCTATACCGTGGCTTTCTCTACATGAACTACGCCGGAAAAGACCAAGACGTCTTTGCGGGCTACGGAAATCAG
AGTCATGGCCGATTAAAGGCAACCGCCGCGAGTTGGGACCCCAACCGTGTTTTTCAACATCTGTGGAGAGGTTAT
TTTAAGCTGTAA
Gene >Ophio5|360
ATGTGCCAAATCAATTCAATCCAGTACAGGTAAATAAATAACTCTGCATGGTGTTGTCTTAGAAGAAAGCCAGGT
CCACCTTGCGTAGTGCCCCTAACCTTGGCCAGAAAATGCCGCTACTGTGGCCTTGTCATGGACCTTCGGAGCCTC
GGCACCACGACCTTCTTTTTTTTTTCGCCGATAGTCTCGGTTCAGCACAGGCAGGCTCGTCCTTTTCGAAAGACT
TCGCCATGGTTGATTTATCCCCACACCGATCCAAGGCCAAGTATACCCCGAACGCAGTCAAGCTCTCGAAGTGGA
GGACGGCGTTGGAGATGATGGCGACGGTTTTTGTAGCCATCGTCCTGTTAGCTGTAACAGCCAGTCCGAATGATT
CTGCAGACCCCGTAAGATGAAGCCCCTCGCGGGCCCCCTGGGGGAAGGACTGACCTCCCACGCAGTGCCTTGCCT
TATCCCAAGCCTTGCCGGGGACAGTCAATCTACCCAATTCGACTCTTTACCAGGCAGAGAACAGGTACTGGTCCA
CACGACAAGCAGAAGTGCATCCACAGTGCTTCGTAGCCCCGCGGACCGCCTTGGAGGTTTCCCAAACCGTCAAAT
TACTCACATCACTCAGAACCCCCTTTTCTGTCAAATCCGGTGGTCACACTGCCTTTGAGGGGGGCTCCAATAACC
ACAACGGCGTCACCATAGATTTAGTCAACCTCAACGAAATTACCATTTCGGAGGATCGCGGAACCGTCTCTGTAG
GGGCTGGAAACCGATGGATCAATGTGTCCCGGGTTCTTGACAACCAGGGCTTGGCTGTTGTTGGCGGCAGAGCTG
CGGATGTCGGCGTGGGCGGCCTCATCCTTGGCGGTGGCATCTCCTTCTTCTCCGGAACTCGAGGTTGGGCCTGCG
ACAACGTCCGCAACTACGAGATCGTCGTTTCCTCCGGCCAAGTTGTCAACGCTTCGCCGTCGGTGAACCCTGATT
TGTACTGGGCCCTTCGCGGTGGCGGGGGCTCCAATTTCGGAATCGTCACTCGCTTCGACCTTGAAGCCTTCCCTC
AGGGCGATTTATGGGCGAGCTCCATCGTCTTCCCTGGCTCCCTCAATAGGACCATCGTCTCACTCTTTACAGACT
TCAGCAGTAGAGGCTTTATTGAAGACCCGTCGGCCCATTCCTATCTAGTCATGGGTTATCAGCAGCTCGCTGGAC
ACTTCTTCGTCCTCACGAGCTTCTTCCATCCCGAGCCGTTGCCAGAAAACGCCGTGCCGTCCGTTTTCCTCCCTT
TTCACTCTGTTCCTGGCGGCATGCCGGCCACCAACGGCACACACCTGGCAAAGGTCTCAACGCTATCTATGGCTA
TCGACCAGCCCTCCGGCTCCCGCCAGACGTGGTGGGACACGTCTGTCCACGTGAAGTCGTCGAAACTATTTGAAG
ACATCGTTTCTCTCTTTGCAGCTTACGTCCAAGACCTCCTTGTTTCCGCGGGAACAGCCGGTTTTTTCACACCCT
TCTTGGTCTTTCAGCCGATATCTCCAGGCGTCATTCAGGCCATGCAAAAGAATGGCGGCAATGCACTTGGCTTAA
TACCCGACGATGGGCCGCTCATGATTGTACAGTTGGCAATTGCTTGGAACGATGAAGGGCTGGATTCACAAGTCG
AAAAGTCCTCGGCAGCCCTGATTCAGCAGATTAATGAACTTGCCAAAGAAAAGGGGCTATACCGTGGCTTTCTCT
ACATGAACTACGCCGGAAAAGACCAAGACGTCTTTGCGGGCTACGGAAATCAGAGTCATGGCCGATTAAAGGCAA
CCGCCGCGAGTTGGGACCCCAACCGTGTTTTTCAACATCTGTGGAGAGGTTATTTTAAGCTGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail