Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3587
Gene name
Locationscaffold_283:12249..12613
Strand-
Gene length (bp)364
Transcript length (bp)279
Coding sequence length (bp)276
Protein length (aa) 92

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O13973|MRP10_SCHPO 37S ribosomal protein mrp10, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mrp10 PE=3 SV=1 9 85 4.0E-09
sp|O75012|MRP10_YEAST 37S ribosomal protein MRP10, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRP10 PE=1 SV=1 9 81 1.0E-08
sp|Q756Q5|MRP10_ASHGO 37S ribosomal protein MRP10, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MRP10 PE=3 SV=1 7 81 2.0E-07

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 49 0.5

Transmembrane Domains

Domain # Start End Length
1 31 53 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3587
MSSGRNSMRLPPLKVLRVHTPKRKPENPCVAIMSSVLACWASAGFTAAGCAVLETQLRQCMDGPPPPAAATNTIN
YHLGRMKKYLINKGKYK
Coding >Ophio5|3587
ATGAGCAGCGGCCGCAATTCCATGCGCCTGCCGCCGCTCAAGGTTCTACGCGTGCACACGCCGAAGCGCAAGCCG
GAGAACCCGTGCGTGGCCATCATGTCCAGCGTTCTCGCCTGCTGGGCTTCCGCTGGCTTCACCGCCGCTGGTTGT
GCCGTTCTCGAGACGCAGCTGCGTCAGTGTATGGATGGGCCGCCGCCGCCGGCGGCCGCGACGAATACCATCAAC
TACCATCTCGGCCGTATGAAGAAATACCTCATCAACAAGGGGAAATACAAG
Transcript >Ophio5|3587
ATGAGCAGCGGCCGCAATTCCATGCGCCTGCCGCCGCTCAAGGTTCTACGCGTGCACACGCCGAAGCGCAAGCCG
GAGAACCCGTGCGTGGCCATCATGTCCAGCGTTCTCGCCTGCTGGGCTTCCGCTGGCTTCACCGCCGCTGGTTGT
GCCGTTCTCGAGACGCAGCTGCGTCAGTGTATGGATGGGCCGCCGCCGCCGGCGGCCGCGACGAATACCATCAAC
TACCATCTCGGCCGTATGAAGAAATACCTCATCAACAAGGGGAAATACAAGTGA
Gene >Ophio5|3587
ATGAGCAGCGGCCGCAATTCCATGCGCCTGCCGCCGCTCAAGGTTCTACGCGTGCACACGCCGAAGCGCAAGCCG
GAGAACCCGTGCGTGGCCATCATGTCCAGCGTTCTCGGTGCGATTGCCTATTCCCCAAATTCCCCCCCCTTCACT
CGCAAAGGATATGAGGCTTATGGCGGAATTCTGCTACGGGTATCTAGCCTGCTGGGCTTCCGCTGGCTTCACCGC
CGCTGGTTGTGCCGTTCTCGAGACGCAGCTGCGTCAGTGTATGGATGGGCCGCCGCCGCCGGCGGCCGCGACGAA
TACCATCAACTACCATCTCGGCCGTATGAAGAAATACCTCATCAACAAGGGGAAATACAAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail