Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3581
Gene name
Locationscaffold_282:15415..17141
Strand+
Gene length (bp)1726
Transcript length (bp)1665
Coding sequence length (bp)1662
Protein length (aa) 554

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 1.5E-27 84 437
PF07690 MFS_1 Major Facilitator Superfamily 5.7E-09 390 544

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P6J7|YHD3_SCHPO Uncharacterized MFS-type transporter C1683.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.03c PE=3 SV=1 115 538 6.0E-28
sp|Q08902|YO378_YEAST Drug resistance protein YOR378W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR378W PE=1 SV=1 111 530 6.0E-27
sp|P9WG87|Y1250_MYCTU Uncharacterized MFS-type transporter Rv1250 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1250 PE=3 SV=1 88 491 5.0E-21
sp|P9WG86|Y1250_MYCTO Uncharacterized MFS-type transporter MT1289 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1289 PE=3 SV=1 88 491 5.0E-21
sp|Q04733|CMCT_AMYLA Cephamycin export protein CmcT OS=Amycolatopsis lactamdurans GN=cmcT PE=3 SV=1 87 537 8.0E-19
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P6J7|YHD3_SCHPO Uncharacterized MFS-type transporter C1683.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.03c PE=3 SV=1 115 538 6.0E-28
sp|Q08902|YO378_YEAST Drug resistance protein YOR378W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR378W PE=1 SV=1 111 530 6.0E-27
sp|P9WG87|Y1250_MYCTU Uncharacterized MFS-type transporter Rv1250 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1250 PE=3 SV=1 88 491 5.0E-21
sp|P9WG86|Y1250_MYCTO Uncharacterized MFS-type transporter MT1289 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1289 PE=3 SV=1 88 491 5.0E-21
sp|Q04733|CMCT_AMYLA Cephamycin export protein CmcT OS=Amycolatopsis lactamdurans GN=cmcT PE=3 SV=1 87 537 8.0E-19
sp|Q00538|MMR_BACSU Methylenomycin A resistance protein OS=Bacillus subtilis (strain 168) GN=mmr PE=3 SV=1 78 496 1.0E-17
sp|P9WG89|EMRB_MYCTU Multidrug resistance protein B homolog OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=emrB PE=3 SV=1 38 400 2.0E-16
sp|P9WG88|EMRB_MYCTO Multidrug resistance protein B homolog OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=emrB PE=3 SV=1 38 400 3.0E-16
sp|P39886|TCMA_STRGA Tetracenomycin C resistance and export protein OS=Streptomyces glaucescens GN=tcmA PE=3 SV=1 47 499 1.0E-15
sp|P13090|ATR1_YEAST Aminotriazole resistance protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATR1 PE=1 SV=2 117 529 6.0E-14
sp|Q03263|YM8M_YEAST Uncharacterized transporter YMR279C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR279C PE=1 SV=1 104 538 2.0E-13
sp|P9WJW9|Y2459_MYCTU Uncharacterized MFS-type transporter Rv2459 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2459 PE=3 SV=1 88 397 3.0E-13
sp|P9WJW8|Y2459_MYCTO Uncharacterized MFS-type transporter MT2534 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT2534 PE=3 SV=1 88 397 3.0E-13
sp|Q10072|YAN6_SCHPO Uncharacterized transporter C3H1.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H1.06c PE=3 SV=1 7 407 2.0E-12
sp|P31474|HSRA_ECOLI Probable transport protein HsrA OS=Escherichia coli (strain K12) GN=hsrA PE=1 SV=1 88 347 6.0E-12
sp|P0A0J9|QACA_STAAU Antiseptic resistance protein OS=Staphylococcus aureus GN=qacA PE=1 SV=1 75 388 8.0E-12
sp|P0A0J8|QACA_STAAM Antiseptic resistance protein OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=qacA PE=3 SV=1 75 388 8.0E-12
sp|Q8ZNQ0|MDTD_SALTY Putative multidrug resistance protein MdtD OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=mdtD PE=3 SV=1 88 291 5.0E-11
sp|Q8Z5F5|MDTD_SALTI Putative multidrug resistance protein MdtD OS=Salmonella typhi GN=mdtD PE=3 SV=1 88 291 9.0E-11
sp|B5BF67|MDTD_SALPK Putative multidrug resistance protein MdtD OS=Salmonella paratyphi A (strain AKU_12601) GN=mdtD PE=3 SV=1 88 291 1.0E-10
sp|B5XPB7|MDTD_KLEP3 Putative multidrug resistance protein MdtD OS=Klebsiella pneumoniae (strain 342) GN=mdtD PE=3 SV=1 88 511 1.0E-10
sp|B4T9U3|MDTD_SALHS Putative multidrug resistance protein MdtD OS=Salmonella heidelberg (strain SL476) GN=mdtD PE=3 SV=1 88 291 1.0E-10
sp|Q5PDW9|MDTD_SALPA Putative multidrug resistance protein MdtD OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=mdtD PE=3 SV=1 88 291 1.0E-10
sp|B5EXV9|MDTD_SALA4 Putative multidrug resistance protein MdtD OS=Salmonella agona (strain SL483) GN=mdtD PE=3 SV=1 88 291 1.0E-10
sp|B5R0C2|MDTD_SALEP Putative multidrug resistance protein MdtD OS=Salmonella enteritidis PT4 (strain P125109) GN=mdtD PE=3 SV=1 88 291 1.0E-10
sp|B4SXW2|MDTD_SALNS Putative multidrug resistance protein MdtD OS=Salmonella newport (strain SL254) GN=mdtD PE=3 SV=1 88 291 1.0E-10
sp|B5FMU8|MDTD_SALDC Putative multidrug resistance protein MdtD OS=Salmonella dublin (strain CT_02021853) GN=mdtD PE=3 SV=1 88 291 1.0E-10
sp|Q9HE13|YI32_SCHPO Uncharacterized MFS-type transporter C1399.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1399.02 PE=3 SV=1 47 498 1.0E-10
sp|A9N7L0|MDTD_SALPB Putative multidrug resistance protein MdtD OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=mdtD PE=3 SV=1 88 291 2.0E-10
sp|B4TNI8|MDTD_SALSV Putative multidrug resistance protein MdtD OS=Salmonella schwarzengrund (strain CVM19633) GN=mdtD PE=3 SV=1 88 291 2.0E-10
sp|A6TBH6|MDTD_KLEP7 Putative multidrug resistance protein MdtD OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=mdtD PE=3 SV=1 88 511 4.0E-10
sp|P9WJY5|EFPA_MYCTU Uncharacterized MFS-type transporter EfpA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=efpA PE=1 SV=1 37 285 5.0E-10
sp|P9WJY4|EFPA_MYCTO Uncharacterized MFS-type transporter EfpA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=efpA PE=3 SV=1 37 285 5.0E-10
sp|P46105|ACT22_STRCO Probable actinorhodin transporter OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=actII-2 PE=3 SV=1 39 296 2.0E-09
sp|P96712|BMR3_BACSU Multidrug resistance protein 3 OS=Bacillus subtilis (strain 168) GN=bmr3 PE=1 SV=1 89 401 3.0E-09
sp|P11545|MMR_STRCO Methylenomycin A resistance protein OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=mmr PE=3 SV=1 89 502 4.0E-09
sp|O32182|YUSP_BACSU Uncharacterized MFS-type transporter YusP OS=Bacillus subtilis (strain 168) GN=yusP PE=3 SV=1 71 238 5.0E-09
sp|P0AEJ0|EMRB_ECOLI Multidrug export protein EmrB OS=Escherichia coli (strain K12) GN=emrB PE=1 SV=1 72 250 9.0E-09
sp|P0AEJ1|EMRB_ECO57 Multidrug export protein EmrB OS=Escherichia coli O157:H7 GN=emrB PE=3 SV=1 72 250 9.0E-09
sp|O34502|YVKA_BACSU Uncharacterized MFS-type transporter YvkA OS=Bacillus subtilis (strain 168) GN=yvkA PE=3 SV=1 75 203 2.0E-08
sp|P46104|LMRA_STRLN Lincomycin resistance protein OS=Streptomyces lincolnensis GN=lmrA PE=3 SV=1 71 298 2.0E-08
sp|Q0T353|MDTD_SHIF8 Putative multidrug resistance protein MdtD OS=Shigella flexneri serotype 5b (strain 8401) GN=mdtD PE=3 SV=2 88 185 2.0E-08
sp|Q8X7I3|MDTD_ECO57 Putative multidrug resistance protein MdtD OS=Escherichia coli O157:H7 GN=mdtD PE=3 SV=1 88 185 4.0E-08
sp|B7NQA9|MDTD_ECO7I Putative multidrug resistance protein MdtD OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=mdtD PE=3 SV=1 88 185 4.0E-08
sp|B7NCB3|MDTD_ECOLU Putative multidrug resistance protein MdtD OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=mdtD PE=3 SV=1 88 185 4.0E-08
sp|Q8FG02|MDTD_ECOL6 Putative multidrug resistance protein MdtD OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=mdtD PE=3 SV=1 88 185 4.0E-08
sp|Q323D8|MDTD_SHIBS Putative multidrug resistance protein MdtD OS=Shigella boydii serotype 4 (strain Sb227) GN=mdtD PE=3 SV=1 88 185 4.0E-08
sp|Q3Z0C7|MDTD_SHISS Putative multidrug resistance protein MdtD OS=Shigella sonnei (strain Ss046) GN=mdtD PE=3 SV=1 88 185 4.0E-08
sp|A1ACT2|MDTD_ECOK1 Putative multidrug resistance protein MdtD OS=Escherichia coli O1:K1 / APEC GN=mdtD PE=3 SV=1 88 185 4.0E-08
sp|B7ME89|MDTD_ECO45 Putative multidrug resistance protein MdtD OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=mdtD PE=3 SV=1 88 185 4.0E-08
sp|B5YUD5|MDTD_ECO5E Putative multidrug resistance protein MdtD OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=mdtD PE=3 SV=1 88 185 4.0E-08
sp|C6DBD0|MDTD_PECCP Putative multidrug resistance protein MdtD OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=mdtD PE=3 SV=1 88 407 4.0E-08
sp|A8GHR1|MDTD_SERP5 Putative multidrug resistance protein MdtD OS=Serratia proteamaculans (strain 568) GN=mdtD PE=3 SV=1 88 513 4.0E-08
sp|Q1R9Z4|MDTD_ECOUT Putative multidrug resistance protein MdtD OS=Escherichia coli (strain UTI89 / UPEC) GN=mdtD PE=3 SV=1 88 185 4.0E-08
sp|B6HYS2|MDTD_ECOSE Putative multidrug resistance protein MdtD OS=Escherichia coli (strain SE11) GN=mdtD PE=3 SV=1 88 185 4.0E-08
sp|B7M460|MDTD_ECO8A Putative multidrug resistance protein MdtD OS=Escherichia coli O8 (strain IAI1) GN=mdtD PE=3 SV=1 88 185 4.0E-08
sp|B2TYA6|MDTD_SHIB3 Putative multidrug resistance protein MdtD OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=mdtD PE=3 SV=1 88 185 5.0E-08
sp|A7ZNQ0|MDTD_ECO24 Putative multidrug resistance protein MdtD OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=mdtD PE=3 SV=1 88 185 5.0E-08
sp|C4ZSG5|MDTD_ECOBW Putative multidrug resistance protein MdtD OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=mdtD PE=3 SV=1 88 185 5.0E-08
sp|B1X7H3|MDTD_ECODH Putative multidrug resistance protein MdtD OS=Escherichia coli (strain K12 / DH10B) GN=mdtD PE=3 SV=1 88 185 5.0E-08
sp|A8A1U9|MDTD_ECOHS Putative multidrug resistance protein MdtD OS=Escherichia coli O9:H4 (strain HS) GN=mdtD PE=3 SV=1 88 185 5.0E-08
sp|B1IYZ7|MDTD_ECOLC Putative multidrug resistance protein MdtD OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=mdtD PE=3 SV=1 88 185 5.0E-08
sp|P36554|MDTD_ECOLI Putative multidrug resistance protein MdtD OS=Escherichia coli (strain K12) GN=mdtD PE=1 SV=2 88 185 5.0E-08
sp|B7MWZ0|MDTD_ECO81 Putative multidrug resistance protein MdtD OS=Escherichia coli O81 (strain ED1a) GN=mdtD PE=3 SV=1 88 185 5.0E-08
sp|B1LNW4|MDTD_ECOSM Putative multidrug resistance protein MdtD OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=mdtD PE=3 SV=1 88 185 5.0E-08
sp|B7UTB5|MDTD_ECO27 Putative multidrug resistance protein MdtD OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=mdtD PE=3 SV=1 88 185 5.0E-08
sp|Q0TG13|MDTD_ECOL5 Putative multidrug resistance protein MdtD OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=mdtD PE=3 SV=1 88 185 5.0E-08
sp|Q83QZ0|MDTD_SHIFL Putative multidrug resistance protein MdtD OS=Shigella flexneri GN=mdtD PE=3 SV=1 88 185 5.0E-08
sp|B7L9V0|MDTD_ECO55 Putative multidrug resistance protein MdtD OS=Escherichia coli (strain 55989 / EAEC) GN=mdtD PE=3 SV=1 88 185 5.0E-08
sp|Q04301|VBA1_YEAST Vacuolar basic amino acid transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA1 PE=1 SV=1 71 392 7.0E-08
sp|Q6D2A9|MDTD_PECAS Putative multidrug resistance protein MdtD OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=mdtD PE=3 SV=1 88 252 1.0E-07
sp|A4WCC3|MDTD_ENT38 Putative multidrug resistance protein MdtD OS=Enterobacter sp. (strain 638) GN=mdtD PE=3 SV=1 88 316 2.0E-07
sp|A8AEE4|MDTD_CITK8 Putative multidrug resistance protein MdtD OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=mdtD PE=3 SV=1 88 291 2.0E-07
sp|B7LV41|MDTD_ESCF3 Putative multidrug resistance protein MdtD OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=mdtD PE=3 SV=1 88 185 3.0E-07
sp|P9WG90|STP_MYCTO Multidrug resistance protein Stp OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=stp PE=3 SV=1 88 409 4.0E-07
sp|P44927|EMRB_HAEIN Multidrug export protein EmrB OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=emrB PE=3 SV=1 88 250 5.0E-07
sp|P9WG91|STP_MYCTU Multidrug resistance protein Stp OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=stp PE=1 SV=1 88 409 5.0E-07
sp|P42670|PUR8_STRAD Puromycin resistance protein pur8 OS=Streptomyces alboniger GN=pur8 PE=3 SV=1 96 549 7.0E-07
sp|P94574|YWOD_BACSU Uncharacterized MFS-type transporter YwoD OS=Bacillus subtilis (strain 168) GN=ywoD PE=3 SV=1 70 258 2.0E-06
sp|Q668C4|MDTD_YERPS Putative multidrug resistance protein MdtD OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=mdtD PE=3 SV=1 88 291 2.0E-06
sp|P9WG84|Y1877_MYCTO Uncharacterized MFS-type transporter MT1926 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1926 PE=3 SV=1 80 393 2.0E-06
sp|P9WG85|Y1877_MYCTU Uncharacterized MFS-type transporter Rv1877 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1877 PE=3 SV=1 80 393 2.0E-06
sp|P76269|YEBQ_ECOLI Uncharacterized transporter YebQ OS=Escherichia coli (strain K12) GN=yebQ PE=3 SV=2 44 300 2.0E-06
sp|A1JKW8|MDTD_YERE8 Putative multidrug resistance protein MdtD OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=mdtD PE=3 SV=2 88 496 2.0E-06
sp|B1JSD2|MDTD_YERPY Putative multidrug resistance protein MdtD OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=mdtD PE=3 SV=1 88 291 3.0E-06
sp|A4TMR4|MDTD_YERPP Putative multidrug resistance protein MdtD OS=Yersinia pestis (strain Pestoides F) GN=mdtD PE=3 SV=1 88 291 3.0E-06
sp|Q1CK62|MDTD_YERPN Putative multidrug resistance protein MdtD OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=mdtD PE=3 SV=1 88 291 3.0E-06
sp|A9QZU7|MDTD_YERPG Putative multidrug resistance protein MdtD OS=Yersinia pestis bv. Antiqua (strain Angola) GN=mdtD PE=3 SV=1 88 291 3.0E-06
sp|Q7CJL1|MDTD_YERPE Putative multidrug resistance protein MdtD OS=Yersinia pestis GN=mdtD PE=3 SV=1 88 291 3.0E-06
sp|B2K9M2|MDTD_YERPB Putative multidrug resistance protein MdtD OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=mdtD PE=3 SV=1 88 291 3.0E-06
sp|Q1C5L8|MDTD_YERPA Putative multidrug resistance protein MdtD OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=mdtD PE=3 SV=1 88 291 3.0E-06
sp|A7FG15|MDTD_YERP3 Putative multidrug resistance protein MdtD OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=mdtD PE=3 SV=1 88 291 3.0E-06
sp|A7MHI9|MDTD_CROS8 Putative multidrug resistance protein MdtD OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=mdtD PE=3 SV=1 88 185 3.0E-06
sp|P37594|SMVA_SALTY Methyl viologen resistance protein SmvA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=smvA PE=3 SV=2 75 407 6.0E-06
sp|D0ZXQ3|SMVA_SALT1 Methyl viologen resistance protein SmvA OS=Salmonella typhimurium (strain 14028s / SGSC 2262) GN=smvA PE=1 SV=1 75 407 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 53 0.45

Transmembrane Domains

Domain # Start End Length
1 79 101 22
2 116 138 22
3 145 167 22
4 177 196 19
5 203 225 22
6 235 256 21
7 276 295 19
8 305 327 22
9 340 362 22
10 382 404 22
11 411 430 19
12 440 462 22
13 475 497 22
14 522 541 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3581
MGRASVKATQDSASHMSPSQDVFLSADSPRHHDDAPKPEPDDAPKPEPDDAPKPEPTRPASIQSLPVGYVNKAAR
AYTIIVYLTLVNFMTSVSTGLITTGIPTIAAELNISAQTLYWPLSVYSLTTGTCLIVAGTVADVVGSRRVFLAGT
LLLSAFTLGCGLSGTGLQLTMFRAMQGISVAMCLPTSVGILCNAIAPGRIRNVAFACTGLGQPLGFSTGLVLGGV
FINTVGWRPGWYMAAATLLLCVPLGFVLLPVDRLAEPPSLQRLRTRVDWPGAIIESSCFAMLAFVLVQISEDRKL
IHDGTVIALLTLSLLLMPVFVWWMAFAAKHRLPVLIPNRLWTRLTFSTVCIMVMMSYAVMQVLELYATLFFQKVQ
RLDPLQSSIRLLPSMLVGAALNLTIGLFIHRLSAVWLVFSTSIACAGSPLIMALIRPEWPYWYAAFPAQLLHPLS
ADVLFCVGLIVISQVFPKDTKALAGAVFNTVAQFGTALGLAIIGIIADSVTEASGEQDKASPAALLQGYKAAFWA
TFGLTLAIAVVSIIGLRKTGSANDVREDE
Coding >Ophio5|3581
ATGGGCCGAGCCTCGGTCAAGGCCACCCAAGACAGTGCGTCACATATGAGTCCATCGCAGGACGTCTTTCTCTCC
GCCGACTCTCCACGCCATCATGATGATGCCCCCAAACCGGAGCCGGATGATGCCCCCAAACCGGAGCCGGATGAT
GCCCCCAAACCGGAGCCGACTCGGCCTGCCTCCATCCAGTCCCTTCCAGTAGGATACGTGAACAAAGCAGCAAGG
GCTTACACCATCATCGTCTACCTCACGCTCGTCAACTTCATGACGAGCGTCAGCACAGGCCTCATCACCACCGGT
ATCCCCACCATAGCCGCCGAGCTCAACATCTCAGCCCAGACACTATACTGGCCCTTATCCGTCTACAGCCTGACG
ACGGGAACATGCCTCATCGTCGCCGGCACCGTGGCCGACGTCGTGGGCAGCAGACGCGTCTTCCTCGCCGGCACC
CTCCTCCTCTCCGCCTTCACCCTCGGCTGCGGTCTCTCCGGCACGGGCCTTCAGCTGACCATGTTTCGCGCCATG
CAGGGCATCTCCGTCGCCATGTGTCTTCCCACCTCGGTCGGCATCCTCTGTAATGCCATTGCCCCCGGTCGGATC
CGAAACGTCGCTTTCGCCTGTACGGGCCTCGGTCAGCCTCTGGGCTTCTCTACCGGTCTAGTCCTCGGCGGCGTC
TTCATCAACACGGTCGGATGGCGGCCGGGCTGGTACATGGCCGCTGCTACGCTTCTCCTCTGCGTTCCCCTGGGT
TTCGTCCTGTTGCCGGTTGATCGACTGGCCGAGCCGCCGTCGCTACAGCGGCTCCGGACGAGGGTGGACTGGCCC
GGCGCCATCATCGAGTCTTCGTGCTTCGCCATGCTCGCCTTTGTACTCGTCCAGATCTCCGAGGACCGCAAGCTG
ATACACGACGGCACCGTCATAGCTCTACTCACTCTCAGTCTGCTCCTCATGCCCGTCTTTGTCTGGTGGATGGCA
TTTGCCGCCAAGCATCGACTGCCGGTCCTCATCCCCAACCGGCTCTGGACTCGTCTGACTTTCTCGACCGTCTGC
ATCATGGTCATGATGTCTTATGCCGTCATGCAGGTCCTCGAACTATACGCCACCCTCTTCTTTCAGAAAGTCCAA
CGGCTGGATCCGCTGCAGTCTTCCATCCGTCTGCTGCCTTCTATGCTTGTCGGTGCCGCCCTCAACCTAACCATC
GGTCTGTTCATTCATCGCCTGTCAGCCGTCTGGCTCGTCTTTTCCACCTCGATTGCCTGCGCAGGCTCACCTCTC
ATCATGGCCTTGATCAGGCCGGAATGGCCATACTGGTATGCCGCCTTTCCAGCCCAGCTGCTGCATCCCCTGTCG
GCCGACGTCCTTTTCTGCGTCGGCCTCATCGTCATAAGCCAGGTGTTCCCCAAAGACACCAAAGCCCTCGCCGGC
GCCGTCTTCAATACCGTAGCTCAGTTCGGCACTGCGCTGGGGCTGGCCATCATCGGCATCATCGCAGACTCCGTC
ACAGAAGCCTCCGGCGAGCAAGACAAGGCTAGTCCGGCAGCTCTGCTTCAAGGCTACAAGGCCGCCTTCTGGGCA
ACGTTTGGCTTGACGCTCGCCATAGCCGTCGTCTCCATCATAGGGCTGAGAAAGACGGGATCGGCAAACGACGTC
CGGGAGGATGAA
Transcript >Ophio5|3581
ATGGGCCGAGCCTCGGTCAAGGCCACCCAAGACAGTGCGTCACATATGAGTCCATCGCAGGACGTCTTTCTCTCC
GCCGACTCTCCACGCCATCATGATGATGCCCCCAAACCGGAGCCGGATGATGCCCCCAAACCGGAGCCGGATGAT
GCCCCCAAACCGGAGCCGACTCGGCCTGCCTCCATCCAGTCCCTTCCAGTAGGATACGTGAACAAAGCAGCAAGG
GCTTACACCATCATCGTCTACCTCACGCTCGTCAACTTCATGACGAGCGTCAGCACAGGCCTCATCACCACCGGT
ATCCCCACCATAGCCGCCGAGCTCAACATCTCAGCCCAGACACTATACTGGCCCTTATCCGTCTACAGCCTGACG
ACGGGAACATGCCTCATCGTCGCCGGCACCGTGGCCGACGTCGTGGGCAGCAGACGCGTCTTCCTCGCCGGCACC
CTCCTCCTCTCCGCCTTCACCCTCGGCTGCGGTCTCTCCGGCACGGGCCTTCAGCTGACCATGTTTCGCGCCATG
CAGGGCATCTCCGTCGCCATGTGTCTTCCCACCTCGGTCGGCATCCTCTGTAATGCCATTGCCCCCGGTCGGATC
CGAAACGTCGCTTTCGCCTGTACGGGCCTCGGTCAGCCTCTGGGCTTCTCTACCGGTCTAGTCCTCGGCGGCGTC
TTCATCAACACGGTCGGATGGCGGCCGGGCTGGTACATGGCCGCTGCTACGCTTCTCCTCTGCGTTCCCCTGGGT
TTCGTCCTGTTGCCGGTTGATCGACTGGCCGAGCCGCCGTCGCTACAGCGGCTCCGGACGAGGGTGGACTGGCCC
GGCGCCATCATCGAGTCTTCGTGCTTCGCCATGCTCGCCTTTGTACTCGTCCAGATCTCCGAGGACCGCAAGCTG
ATACACGACGGCACCGTCATAGCTCTACTCACTCTCAGTCTGCTCCTCATGCCCGTCTTTGTCTGGTGGATGGCA
TTTGCCGCCAAGCATCGACTGCCGGTCCTCATCCCCAACCGGCTCTGGACTCGTCTGACTTTCTCGACCGTCTGC
ATCATGGTCATGATGTCTTATGCCGTCATGCAGGTCCTCGAACTATACGCCACCCTCTTCTTTCAGAAAGTCCAA
CGGCTGGATCCGCTGCAGTCTTCCATCCGTCTGCTGCCTTCTATGCTTGTCGGTGCCGCCCTCAACCTAACCATC
GGTCTGTTCATTCATCGCCTGTCAGCCGTCTGGCTCGTCTTTTCCACCTCGATTGCCTGCGCAGGCTCACCTCTC
ATCATGGCCTTGATCAGGCCGGAATGGCCATACTGGTATGCCGCCTTTCCAGCCCAGCTGCTGCATCCCCTGTCG
GCCGACGTCCTTTTCTGCGTCGGCCTCATCGTCATAAGCCAGGTGTTCCCCAAAGACACCAAAGCCCTCGCCGGC
GCCGTCTTCAATACCGTAGCTCAGTTCGGCACTGCGCTGGGGCTGGCCATCATCGGCATCATCGCAGACTCCGTC
ACAGAAGCCTCCGGCGAGCAAGACAAGGCTAGTCCGGCAGCTCTGCTTCAAGGCTACAAGGCCGCCTTCTGGGCA
ACGTTTGGCTTGACGCTCGCCATAGCCGTCGTCTCCATCATAGGGCTGAGAAAGACGGGATCGGCAAACGACGTC
CGGGAGGATGAATAG
Gene >Ophio5|3581
ATGGGCCGAGCCTCGGTCAAGGCCACCCAAGACAGTGCGTCACATATGAGTCCATCGCAGGACGTCTTTCTCTCC
GCCGACTCTCCACGCCATCATGATGATGCCCCCAAACCGGAGCCGGATGATGCCCCCAAACCGGAGCCGGATGAT
GCCCCCAAACCGGAGCCGACTCGGCCTGCCTCCATCCAGTCCCTTCCAGTAGGATACGTGAACAAAGCAGCAAGG
GCTTACACCATCATCGTCTACCTCACGCTCGTCAACTTCATGACGAGCGTCAGCACAGGCCTCATCACCACCGGT
ATCCCCACCATAGCCGCCGAGCTCAACATCTCAGCCCAGACACTATACTGGCCCTTATCCGTCTACAGCCTGACG
ACGGGAACATGCCTCATCGTCGCCGGCACCGTGGCCGACGTCGTGGGCAGCAGACGCGTCTTCCTCGCCGGCACC
CTCCTCCTCTCCGCCTTCACCCTCGGCTGCGGTCTCTCCGGCACGGGCCTTCAGCTGACCATGTTTCGCGCCATG
CAGGGCATCTCCGTCGCCATGTGTCTTCCCACCTCGGTCGGCATCCTCTGTAATGCCATTGCCCCCGGTCGGATC
CGAAACGTCGCTTTCGCCTGTACGGGCCTCGGTCAGCCTCTGGGCTTCTCTACCGGTCTAGTCCTCGGCGGCGTC
TTCATCAACACGGTCGGATGGCGGCCGGGCTGGTACATGGCCGCTGCTACGCTTCTCCTCTGCGTTCCCCTGGGT
TTCGTCCTGTTGCCGGTTGATCGACTGGCCGAGCCGCCGTCGCTACAGCGGCTCCGGACGAGGGTGGACTGGCCC
GGCGCCATCATCGAGTCTTCGTGCTTCGCCATGCTCGCCTTTGTACTCGTCCAGATCTCCGAGGACCGCAAGCTG
ATACACGACGGCACCGTCATAGCTCTACTCACTCTCAGTCTGCTCCTCATGCCCGTCTTTGTCTGGTGGATGGCA
TTTGCCGCCAAGCATCGACTGCCGGTCCTCATCCCCAACCGGCTCTGGACTCGTCTGACTTTCTCGACCGTCTGC
ATCATGGTCATGATGTCTTATGCCGTCATGCAGGTCCTCGAACTATACGCCACCCTCTTCTTTCAGAAAGTCCAA
CGGCTGGATCCGCTGCAGTCTTCCATCCGTCTGCTGCCTTCTATGCTTGTCGGTGCCGCCCTCAACCTAACCATC
GGTCTGTTCATTCATCGCCTGTCAGCCGTCTGGCTCGTCTTTTCCACCTCGATTGCCTGCGCAGGCTCACCTCTC
ATCATGGCCTTGATCAGGCCGGAATGGCCATACTGGTATGCCGCCTTTCCAGCCCAGCTGCTGCATCCCGTGAGT
CCTGACCCCCCTCCCCCAAAACTCCTTTCTAAATCCCTCGCTGACCCCCTCCCAGCTGTCGGCCGACGTCCTTTT
CTGCGTCGGCCTCATCGTCATAAGCCAGGTGTTCCCCAAAGACACCAAAGCCCTCGCCGGCGCCGTCTTCAATAC
CGTAGCTCAGTTCGGCACTGCGCTGGGGCTGGCCATCATCGGCATCATCGCAGACTCCGTCACAGAAGCCTCCGG
CGAGCAAGACAAGGCTAGTCCGGCAGCTCTGCTTCAAGGCTACAAGGCCGCCTTCTGGGCAACGTTTGGCTTGAC
GCTCGCCATAGCCGTCGTCTCCATCATAGGGCTGAGAAAGACGGGATCGGCAAACGACGTCCGGGAGGATGAATA
G

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail