Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|358
Gene name
Locationscaffold_1082:241..664
Strand+
Gene length (bp)423
Transcript length (bp)357
Coding sequence length (bp)354
Protein length (aa) 118

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07019 EMC6 EMC6 2.0E-26 24 113

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O59764|YJMB_SCHPO ER membrane protein complex subunit 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1020.11c PE=3 SV=2 4 116 2.0E-17

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.5

Transmembrane Domains

Domain # Start End Length
1 27 44 17
2 49 71 22
3 91 113 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|358
MRSERVYQLCPIVQDSIIHNSKTLANLHNLAASIFGVCAGILGLESYSGFLFYIVLSITITFLFYAMNITFETSA
ERRIILDSSRYFRAAFNFWTSGIATGLSGFILTWTLFYGLVST
Coding >Ophio5|358
ATGCGGTCCGAACGAGTATATCAGCTCTGCCCCATCGTCCAAGACTCTATTATACACAACTCAAAGACGCTTGCC
AATCTCCACAATCTCGCAGCTTCTATCTTCGGTGTATGCGCCGGTATCCTCGGTCTCGAATCTTACAGCGGCTTC
CTCTTCTATATCGTGCTGTCTATCACTATCACCTTTCTTTTCTATGCCATGAATATAACGTTCGAAACCTCAGCC
GAAAGGAGAATTATTCTCGACAGCAGTCGCTATTTCCGGGCGGCTTTCAACTTTTGGACTAGCGGGATAGCAACT
GGGCTATCCGGATTTATATTGACGTGGACTCTATTCTACGGCCTTGTAAGCACG
Transcript >Ophio5|358
ATGCGGTCCGAACGAGTATATCAGCTCTGCCCCATCGTCCAAGACTCTATTATACACAACTCAAAGACGCTTGCC
AATCTCCACAATCTCGCAGCTTCTATCTTCGGTGTATGCGCCGGTATCCTCGGTCTCGAATCTTACAGCGGCTTC
CTCTTCTATATCGTGCTGTCTATCACTATCACCTTTCTTTTCTATGCCATGAATATAACGTTCGAAACCTCAGCC
GAAAGGAGAATTATTCTCGACAGCAGTCGCTATTTCCGGGCGGCTTTCAACTTTTGGACTAGCGGGATAGCAACT
GGGCTATCCGGATTTATATTGACGTGGACTCTATTCTACGGCCTTGTAAGCACGTAA
Gene >Ophio5|358
ATGCGGTCCGAACGAGTATATCAGCTCTGCCCCATCGTCCAAGACTCTATTATACACAACTCAAAGGTTTGCTGT
GGTCCGCTAACAAAAGACCTTCATTTTTCTGACCATGACTTCTCGTCGCTCCTGCAGACGCTTGCCAATCTCCAC
AATCTCGCAGCTTCTATCTTCGGTGTATGCGCCGGTATCCTCGGTCTCGAATCTTACAGCGGCTTCCTCTTCTAT
ATCGTGCTGTCTATCACTATCACCTTTCTTTTCTATGCCATGAATATAACGTTCGAAACCTCAGCCGAAAGGAGA
ATTATTCTCGACAGCAGTCGCTATTTCCGGGCGGCTTTCAACTTTTGGACTAGCGGGATAGCAACTGGGCTATCC
GGATTTATATTGACGTGGACTCTATTCTACGGCCTTGTAAGCACGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail