Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3578
Gene name
Locationscaffold_282:8125..11584
Strand+
Gene length (bp)3459
Transcript length (bp)3459
Coding sequence length (bp)3456
Protein length (aa) 1152

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08487 VIT Vault protein inter-alpha-trypsin domain 5.1E-28 127 239
PF13768 VWA_3 von Willebrand factor type A domain 7.0E-19 407 571
PF13519 VWA_2 von Willebrand factor type A domain 4.0E-09 408 521
PF00092 VWA von Willebrand factor type A domain 8.4E-08 408 566
PF13757 VIT_2 Vault protein inter-alpha-trypsin domain 1.1E-07 122 192

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O00534|VMA5A_HUMAN von Willebrand factor A domain-containing protein 5A OS=Homo sapiens GN=VWA5A PE=2 SV=2 124 743 2.0E-23
sp|Q54DU5|Y2028_DICDI von Willebrand factor A domain-containing protein DDB_G0292028 OS=Dictyostelium discoideum GN=DDB_G0292028 PE=3 SV=1 384 751 7.0E-22
sp|Q54DV3|Y2016_DICDI von Willebrand factor A domain-containing protein DDB_G0292016 OS=Dictyostelium discoideum GN=DDB_G0292016 PE=3 SV=1 146 751 1.0E-18
sp|Q54CQ8|Y2740_DICDI von Willebrand factor A domain-containing protein DDB_G0292740 OS=Dictyostelium discoideum GN=DDB_G0292740 PE=3 SV=1 406 751 3.0E-18
sp|Q54MG1|Y5981_DICDI von Willebrand factor A domain-containing protein DDB_G0285981 OS=Dictyostelium discoideum GN=DDB_G0285981 PE=3 SV=1 384 751 8.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O00534|VMA5A_HUMAN von Willebrand factor A domain-containing protein 5A OS=Homo sapiens GN=VWA5A PE=2 SV=2 124 743 2.0E-23
sp|Q54DU5|Y2028_DICDI von Willebrand factor A domain-containing protein DDB_G0292028 OS=Dictyostelium discoideum GN=DDB_G0292028 PE=3 SV=1 384 751 7.0E-22
sp|Q54DV3|Y2016_DICDI von Willebrand factor A domain-containing protein DDB_G0292016 OS=Dictyostelium discoideum GN=DDB_G0292016 PE=3 SV=1 146 751 1.0E-18
sp|Q54CQ8|Y2740_DICDI von Willebrand factor A domain-containing protein DDB_G0292740 OS=Dictyostelium discoideum GN=DDB_G0292740 PE=3 SV=1 406 751 3.0E-18
sp|Q54MG1|Y5981_DICDI von Willebrand factor A domain-containing protein DDB_G0285981 OS=Dictyostelium discoideum GN=DDB_G0285981 PE=3 SV=1 384 751 8.0E-18
sp|Q54MG4|Y5975_DICDI von Willebrand factor A domain-containing protein DDB_G0285975 OS=Dictyostelium discoideum GN=DDB_G0285975 PE=3 SV=1 384 751 1.0E-17
sp|Q5TIE3|VW5B1_HUMAN von Willebrand factor A domain-containing protein 5B1 OS=Homo sapiens GN=VWA5B1 PE=1 SV=2 398 597 1.0E-16
sp|A9Z1V5|VW5B1_MOUSE von Willebrand factor A domain-containing protein 5B1 OS=Mus musculus GN=Vwa5b1 PE=2 SV=1 382 597 1.0E-15
sp|C7G046|Y6969_DICDI von Willebrand factor A domain-containing protein DDB_G0286969 OS=Dictyostelium discoideum GN=DDB_G0286969 PE=3 SV=1 378 752 1.0E-15
sp|Q99KC8|VMA5A_MOUSE von Willebrand factor A domain-containing protein 5A OS=Mus musculus GN=Vwa5a PE=1 SV=2 386 743 2.0E-14
sp|Q75WE7|VWA5A_RAT von Willebrand factor A domain-containing protein 5A OS=Rattus norvegicus GN=Vwa5a PE=2 SV=1 399 743 1.0E-11
sp|Q55G98|Y7758_DICDI von Willebrand factor A domain-containing protein DDB_G0267758 OS=Dictyostelium discoideum GN=DDB_G0267758 PE=3 SV=1 110 597 1.0E-07
sp|Q9UKK3|PARP4_HUMAN Poly [ADP-ribose] polymerase 4 OS=Homo sapiens GN=PARP4 PE=1 SV=3 124 266 3.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3578
MNRTLKTKRLASGILFSPPTDPSKAAVDIRNPKGKERLPKQTVAYQRWPQNTPQLFMAANSIPREDAEWGPSAIG
EDYNGFHIFPKDLDVPVPVRELSIDSDDEEVSPPLPSSNTDPSPVTYCLPLLSVAADVTVDGIIAVTELRQSYHN
PSTMNIPQARHTFPLYDGAVVTSFECTIGLDRFLRGDVKAKKQAREEFEKARKERLETAALLEELTPEMFETSLG
NIAAHTTVEVKLTYVHELKAVIMAEEMTEGLAITIPVSIAPRYGSPTTAPELASNKLDLWIRVFDDGSINPAGCH
VESAHRASYVGRQAAQKHVASSLAELAILAESSTVKPQMQFVWHYASGSTMLKRDFVLVLQMVQGDRLRSRAVLA
PTNASGQAALMVHVRPNDVFGSAVQPQNFTGEILFVLDRSESMGWTGEGDSRLKIDTMRGAMALALSGLPGTCVF
NIISFGSEVRGLWHESQSAGDAASLQQAKAHLPYIKANMGGTDVLLALKSAISHRMESRQSTQVILITDGEVHSE
PNDPILDFVWRTRRDLGDKVHFFSLGIGDRVSHHIVEAIADLGGGYCDVVDIVTRPRWEGRFTRMLRSAMEPDSW
TCDINLGPGYERRSLLTFRFGEDQLEDKSVAPVVQAPYPLPPLHPYSYKSVFFLVDLRSVEPPSNVFLYTATDGA
KRKMYRLDIEKASLSGGTIHHLAAKAALLSLEDETKRRGSEPDIARANAESLGMQYSVVSKWTSFVAVADDEEAQ
EVDLYKSPFRQIDLHELPSLDEDEASVKSEEDGPVYSASSLPSRPPAGREGVLKSHGCVLPLEVMPDAPPTPFDP
TISVESPCPPPPCLPPPCPPPEPEPELAPPRHLRSVGDDDDDGRNGPLNEASPPSPSTMPLPPPPPALELPAEYH
SHGYPKSVQVQHDNTEKDSDSSWESEDSGELADYQPSVDGSITCEDAMQCQTSDGFVLPAVIRAGLQQHFCIGTG
PWLRHLVQELSPSAHRTEQTLDVMVDSLMMMVYFRTHLAQEEDAWFLLMDKTERSILLSLGFEEDEEDKLEATYD
NLDRTLAHVHFLEACKDSSTERASNEQQESSDQVPKHCPVCDDFYDTAAEKSRTKKGFVCWHDDCFDQRLRSRRV
WPSWHVFWEHQIAEGHVLCPEKEDIAC
Coding >Ophio5|3578
ATGAACCGCACACTCAAGACGAAGCGTCTGGCCTCCGGTATTCTCTTTTCCCCACCGACTGACCCGAGCAAGGCG
GCTGTCGATATTCGCAACCCCAAGGGCAAGGAAAGGCTTCCCAAGCAGACGGTAGCGTACCAGAGATGGCCCCAG
AACACGCCACAGCTATTCATGGCCGCCAACTCGATCCCTCGAGAGGATGCAGAGTGGGGACCAAGTGCCATCGGA
GAAGACTACAATGGCTTCCACATATTTCCAAAGGACCTGGACGTGCCGGTCCCGGTACGTGAACTGTCGATAGAC
TCAGATGACGAGGAGGTGTCTCCCCCCCTTCCCTCGAGCAACACAGATCCTTCCCCGGTAACCTACTGTCTGCCA
CTGCTCAGTGTTGCGGCGGACGTGACGGTAGATGGCATCATTGCCGTGACGGAGCTACGACAAAGCTATCATAAT
CCGTCGACGATGAATATTCCCCAAGCACGACACACGTTCCCCCTTTACGACGGAGCCGTCGTCACCTCTTTCGAG
TGCACAATTGGCCTCGACCGCTTCCTCAGAGGCGATGTGAAGGCGAAGAAGCAGGCCAGGGAAGAGTTTGAAAAG
GCGCGTAAAGAGAGGCTTGAAACGGCCGCGTTGCTGGAGGAGCTCACACCGGAGATGTTTGAGACGTCGTTGGGG
AACATAGCGGCCCATACGACGGTCGAGGTCAAGCTGACGTATGTGCATGAGCTCAAGGCGGTCATCATGGCGGAG
GAGATGACCGAGGGTCTCGCCATCACCATACCAGTGTCCATTGCGCCTCGATACGGCAGTCCAACGACCGCCCCT
GAGTTGGCGAGCAATAAGCTGGATCTCTGGATCAGGGTCTTTGACGACGGATCCATCAACCCGGCAGGCTGCCAT
GTCGAGTCGGCGCACCGAGCAAGCTACGTGGGCCGCCAAGCTGCACAGAAGCACGTCGCCAGCAGCCTAGCGGAA
CTAGCCATCCTAGCAGAGTCGTCGACAGTCAAGCCGCAGATGCAGTTCGTCTGGCACTACGCGTCCGGCTCGACT
ATGCTGAAGCGAGACTTTGTCCTCGTCCTCCAAATGGTTCAAGGGGACCGGCTACGATCACGAGCCGTGCTGGCG
CCGACCAATGCCAGCGGACAGGCCGCCCTGATGGTCCACGTGCGGCCAAACGATGTCTTCGGAAGTGCCGTCCAG
CCGCAGAACTTCACGGGCGAGATCCTCTTCGTCTTGGATCGATCCGAATCCATGGGCTGGACCGGGGAAGGTGAC
AGCAGACTGAAGATTGACACTATGCGCGGTGCCATGGCCCTGGCGCTCTCAGGCTTACCCGGAACGTGCGTCTTC
AACATCATCTCCTTTGGCAGCGAGGTTCGTGGTCTATGGCATGAGTCGCAATCCGCCGGCGACGCTGCCAGTCTC
CAGCAGGCCAAGGCTCATCTGCCCTATATCAAGGCCAACATGGGCGGAACCGATGTGCTACTGGCGCTGAAGTCG
GCCATAAGCCACCGGATGGAGAGCCGGCAGTCGACACAGGTCATCCTCATCACCGACGGCGAGGTCCATAGCGAG
CCAAACGACCCGATCCTTGACTTTGTGTGGCGTACGAGAAGAGACTTGGGCGACAAGGTGCACTTCTTCAGTCTC
GGAATCGGCGATAGAGTCTCGCATCATATTGTCGAGGCTATCGCCGATCTGGGCGGCGGATACTGCGATGTCGTC
GATATAGTAACGCGTCCACGATGGGAGGGTCGATTCACCCGCATGCTTCGATCCGCCATGGAACCCGACAGCTGG
ACATGCGACATCAACCTTGGACCTGGCTACGAAAGACGGAGCTTGCTAACCTTTCGCTTCGGAGAGGACCAGCTA
GAGGACAAGTCGGTCGCTCCCGTCGTTCAAGCCCCCTATCCACTTCCGCCCCTGCATCCGTACAGCTACAAGTCT
GTCTTTTTCCTCGTCGACCTGCGCAGTGTCGAGCCTCCCAGCAACGTCTTTCTATACACGGCCACGGACGGGGCC
AAGAGGAAGATGTATCGGCTCGATATCGAAAAGGCCAGTCTCAGCGGTGGGACCATACACCACCTCGCAGCCAAG
GCCGCCCTACTCAGCCTGGAAGACGAGACGAAGAGACGAGGCTCGGAGCCTGATATTGCACGTGCTAACGCCGAG
TCGCTCGGCATGCAATACTCCGTTGTCAGCAAGTGGACGAGCTTTGTCGCTGTAGCAGACGACGAAGAGGCTCAG
GAGGTCGACCTCTACAAGAGCCCATTCCGGCAAATTGATCTGCACGAGTTGCCCAGTCTCGACGAAGATGAGGCC
TCGGTGAAATCGGAAGAAGACGGACCGGTCTACTCCGCCTCCTCGCTTCCCTCACGGCCTCCTGCTGGAAGGGAA
GGGGTTTTGAAAAGCCATGGCTGTGTCCTCCCCCTTGAAGTCATGCCTGACGCACCACCGACGCCATTTGATCCA
ACTATAAGTGTCGAATCGCCGTGTCCACCACCGCCGTGTCTGCCACCGCCGTGTCCGCCACCGGAGCCGGAACCA
GAGCTTGCCCCTCCGCGGCATTTAAGATCGGTAGGTGATGATGACGACGACGGACGTAATGGTCCACTCAATGAA
GCATCGCCTCCGTCGCCATCGACAATGCCGCTTCCGCCCCCTCCTCCGGCGTTGGAGTTGCCTGCTGAGTACCAC
TCTCACGGATACCCCAAGTCGGTGCAAGTACAGCATGACAACACGGAGAAAGACAGTGACTCTAGCTGGGAGTCT
GAAGATTCTGGAGAGCTGGCCGACTACCAACCCTCTGTTGACGGATCCATCACTTGCGAAGACGCCATGCAATGC
CAGACCAGCGACGGCTTCGTTCTCCCCGCCGTGATACGGGCGGGACTACAACAGCACTTCTGTATCGGAACTGGC
CCTTGGTTGCGCCATCTGGTACAGGAGCTTTCCCCCTCAGCCCATCGGACAGAACAGACTCTAGACGTCATGGTG
GACAGCCTCATGATGATGGTTTACTTCCGCACACACCTCGCCCAGGAGGAAGACGCCTGGTTTCTACTCATGGAC
AAGACGGAGCGTTCCATCCTACTCTCCCTCGGCTTCGAAGAGGACGAGGAAGACAAGCTGGAGGCTACATACGAC
AACCTTGACCGTACACTCGCCCACGTGCACTTCCTCGAAGCATGCAAAGACTCTTCCACCGAGCGAGCAAGCAAC
GAACAACAAGAGTCGTCTGATCAAGTGCCCAAGCACTGTCCCGTCTGCGACGACTTTTACGACACGGCGGCTGAG
AAATCCAGGACGAAAAAGGGGTTTGTCTGCTGGCATGATGATTGTTTTGACCAGCGTTTGAGAAGTCGTCGGGTT
TGGCCGAGCTGGCATGTGTTTTGGGAACACCAGATTGCTGAGGGACATGTCCTGTGTCCTGAAAAGGAGGACATT
GCGTGC
Transcript >Ophio5|3578
ATGAACCGCACACTCAAGACGAAGCGTCTGGCCTCCGGTATTCTCTTTTCCCCACCGACTGACCCGAGCAAGGCG
GCTGTCGATATTCGCAACCCCAAGGGCAAGGAAAGGCTTCCCAAGCAGACGGTAGCGTACCAGAGATGGCCCCAG
AACACGCCACAGCTATTCATGGCCGCCAACTCGATCCCTCGAGAGGATGCAGAGTGGGGACCAAGTGCCATCGGA
GAAGACTACAATGGCTTCCACATATTTCCAAAGGACCTGGACGTGCCGGTCCCGGTACGTGAACTGTCGATAGAC
TCAGATGACGAGGAGGTGTCTCCCCCCCTTCCCTCGAGCAACACAGATCCTTCCCCGGTAACCTACTGTCTGCCA
CTGCTCAGTGTTGCGGCGGACGTGACGGTAGATGGCATCATTGCCGTGACGGAGCTACGACAAAGCTATCATAAT
CCGTCGACGATGAATATTCCCCAAGCACGACACACGTTCCCCCTTTACGACGGAGCCGTCGTCACCTCTTTCGAG
TGCACAATTGGCCTCGACCGCTTCCTCAGAGGCGATGTGAAGGCGAAGAAGCAGGCCAGGGAAGAGTTTGAAAAG
GCGCGTAAAGAGAGGCTTGAAACGGCCGCGTTGCTGGAGGAGCTCACACCGGAGATGTTTGAGACGTCGTTGGGG
AACATAGCGGCCCATACGACGGTCGAGGTCAAGCTGACGTATGTGCATGAGCTCAAGGCGGTCATCATGGCGGAG
GAGATGACCGAGGGTCTCGCCATCACCATACCAGTGTCCATTGCGCCTCGATACGGCAGTCCAACGACCGCCCCT
GAGTTGGCGAGCAATAAGCTGGATCTCTGGATCAGGGTCTTTGACGACGGATCCATCAACCCGGCAGGCTGCCAT
GTCGAGTCGGCGCACCGAGCAAGCTACGTGGGCCGCCAAGCTGCACAGAAGCACGTCGCCAGCAGCCTAGCGGAA
CTAGCCATCCTAGCAGAGTCGTCGACAGTCAAGCCGCAGATGCAGTTCGTCTGGCACTACGCGTCCGGCTCGACT
ATGCTGAAGCGAGACTTTGTCCTCGTCCTCCAAATGGTTCAAGGGGACCGGCTACGATCACGAGCCGTGCTGGCG
CCGACCAATGCCAGCGGACAGGCCGCCCTGATGGTCCACGTGCGGCCAAACGATGTCTTCGGAAGTGCCGTCCAG
CCGCAGAACTTCACGGGCGAGATCCTCTTCGTCTTGGATCGATCCGAATCCATGGGCTGGACCGGGGAAGGTGAC
AGCAGACTGAAGATTGACACTATGCGCGGTGCCATGGCCCTGGCGCTCTCAGGCTTACCCGGAACGTGCGTCTTC
AACATCATCTCCTTTGGCAGCGAGGTTCGTGGTCTATGGCATGAGTCGCAATCCGCCGGCGACGCTGCCAGTCTC
CAGCAGGCCAAGGCTCATCTGCCCTATATCAAGGCCAACATGGGCGGAACCGATGTGCTACTGGCGCTGAAGTCG
GCCATAAGCCACCGGATGGAGAGCCGGCAGTCGACACAGGTCATCCTCATCACCGACGGCGAGGTCCATAGCGAG
CCAAACGACCCGATCCTTGACTTTGTGTGGCGTACGAGAAGAGACTTGGGCGACAAGGTGCACTTCTTCAGTCTC
GGAATCGGCGATAGAGTCTCGCATCATATTGTCGAGGCTATCGCCGATCTGGGCGGCGGATACTGCGATGTCGTC
GATATAGTAACGCGTCCACGATGGGAGGGTCGATTCACCCGCATGCTTCGATCCGCCATGGAACCCGACAGCTGG
ACATGCGACATCAACCTTGGACCTGGCTACGAAAGACGGAGCTTGCTAACCTTTCGCTTCGGAGAGGACCAGCTA
GAGGACAAGTCGGTCGCTCCCGTCGTTCAAGCCCCCTATCCACTTCCGCCCCTGCATCCGTACAGCTACAAGTCT
GTCTTTTTCCTCGTCGACCTGCGCAGTGTCGAGCCTCCCAGCAACGTCTTTCTATACACGGCCACGGACGGGGCC
AAGAGGAAGATGTATCGGCTCGATATCGAAAAGGCCAGTCTCAGCGGTGGGACCATACACCACCTCGCAGCCAAG
GCCGCCCTACTCAGCCTGGAAGACGAGACGAAGAGACGAGGCTCGGAGCCTGATATTGCACGTGCTAACGCCGAG
TCGCTCGGCATGCAATACTCCGTTGTCAGCAAGTGGACGAGCTTTGTCGCTGTAGCAGACGACGAAGAGGCTCAG
GAGGTCGACCTCTACAAGAGCCCATTCCGGCAAATTGATCTGCACGAGTTGCCCAGTCTCGACGAAGATGAGGCC
TCGGTGAAATCGGAAGAAGACGGACCGGTCTACTCCGCCTCCTCGCTTCCCTCACGGCCTCCTGCTGGAAGGGAA
GGGGTTTTGAAAAGCCATGGCTGTGTCCTCCCCCTTGAAGTCATGCCTGACGCACCACCGACGCCATTTGATCCA
ACTATAAGTGTCGAATCGCCGTGTCCACCACCGCCGTGTCTGCCACCGCCGTGTCCGCCACCGGAGCCGGAACCA
GAGCTTGCCCCTCCGCGGCATTTAAGATCGGTAGGTGATGATGACGACGACGGACGTAATGGTCCACTCAATGAA
GCATCGCCTCCGTCGCCATCGACAATGCCGCTTCCGCCCCCTCCTCCGGCGTTGGAGTTGCCTGCTGAGTACCAC
TCTCACGGATACCCCAAGTCGGTGCAAGTACAGCATGACAACACGGAGAAAGACAGTGACTCTAGCTGGGAGTCT
GAAGATTCTGGAGAGCTGGCCGACTACCAACCCTCTGTTGACGGATCCATCACTTGCGAAGACGCCATGCAATGC
CAGACCAGCGACGGCTTCGTTCTCCCCGCCGTGATACGGGCGGGACTACAACAGCACTTCTGTATCGGAACTGGC
CCTTGGTTGCGCCATCTGGTACAGGAGCTTTCCCCCTCAGCCCATCGGACAGAACAGACTCTAGACGTCATGGTG
GACAGCCTCATGATGATGGTTTACTTCCGCACACACCTCGCCCAGGAGGAAGACGCCTGGTTTCTACTCATGGAC
AAGACGGAGCGTTCCATCCTACTCTCCCTCGGCTTCGAAGAGGACGAGGAAGACAAGCTGGAGGCTACATACGAC
AACCTTGACCGTACACTCGCCCACGTGCACTTCCTCGAAGCATGCAAAGACTCTTCCACCGAGCGAGCAAGCAAC
GAACAACAAGAGTCGTCTGATCAAGTGCCCAAGCACTGTCCCGTCTGCGACGACTTTTACGACACGGCGGCTGAG
AAATCCAGGACGAAAAAGGGGTTTGTCTGCTGGCATGATGATTGTTTTGACCAGCGTTTGAGAAGTCGTCGGGTT
TGGCCGAGCTGGCATGTGTTTTGGGAACACCAGATTGCTGAGGGACATGTCCTGTGTCCTGAAAAGGAGGACATT
GCGTGCTGA
Gene >Ophio5|3578
ATGAACCGCACACTCAAGACGAAGCGTCTGGCCTCCGGTATTCTCTTTTCCCCACCGACTGACCCGAGCAAGGCG
GCTGTCGATATTCGCAACCCCAAGGGCAAGGAAAGGCTTCCCAAGCAGACGGTAGCGTACCAGAGATGGCCCCAG
AACACGCCACAGCTATTCATGGCCGCCAACTCGATCCCTCGAGAGGATGCAGAGTGGGGACCAAGTGCCATCGGA
GAAGACTACAATGGCTTCCACATATTTCCAAAGGACCTGGACGTGCCGGTCCCGGTACGTGAACTGTCGATAGAC
TCAGATGACGAGGAGGTGTCTCCCCCCCTTCCCTCGAGCAACACAGATCCTTCCCCGGTAACCTACTGTCTGCCA
CTGCTCAGTGTTGCGGCGGACGTGACGGTAGATGGCATCATTGCCGTGACGGAGCTACGACAAAGCTATCATAAT
CCGTCGACGATGAATATTCCCCAAGCACGACACACGTTCCCCCTTTACGACGGAGCCGTCGTCACCTCTTTCGAG
TGCACAATTGGCCTCGACCGCTTCCTCAGAGGCGATGTGAAGGCGAAGAAGCAGGCCAGGGAAGAGTTTGAAAAG
GCGCGTAAAGAGAGGCTTGAAACGGCCGCGTTGCTGGAGGAGCTCACACCGGAGATGTTTGAGACGTCGTTGGGG
AACATAGCGGCCCATACGACGGTCGAGGTCAAGCTGACGTATGTGCATGAGCTCAAGGCGGTCATCATGGCGGAG
GAGATGACCGAGGGTCTCGCCATCACCATACCAGTGTCCATTGCGCCTCGATACGGCAGTCCAACGACCGCCCCT
GAGTTGGCGAGCAATAAGCTGGATCTCTGGATCAGGGTCTTTGACGACGGATCCATCAACCCGGCAGGCTGCCAT
GTCGAGTCGGCGCACCGAGCAAGCTACGTGGGCCGCCAAGCTGCACAGAAGCACGTCGCCAGCAGCCTAGCGGAA
CTAGCCATCCTAGCAGAGTCGTCGACAGTCAAGCCGCAGATGCAGTTCGTCTGGCACTACGCGTCCGGCTCGACT
ATGCTGAAGCGAGACTTTGTCCTCGTCCTCCAAATGGTTCAAGGGGACCGGCTACGATCACGAGCCGTGCTGGCG
CCGACCAATGCCAGCGGACAGGCCGCCCTGATGGTCCACGTGCGGCCAAACGATGTCTTCGGAAGTGCCGTCCAG
CCGCAGAACTTCACGGGCGAGATCCTCTTCGTCTTGGATCGATCCGAATCCATGGGCTGGACCGGGGAAGGTGAC
AGCAGACTGAAGATTGACACTATGCGCGGTGCCATGGCCCTGGCGCTCTCAGGCTTACCCGGAACGTGCGTCTTC
AACATCATCTCCTTTGGCAGCGAGGTTCGTGGTCTATGGCATGAGTCGCAATCCGCCGGCGACGCTGCCAGTCTC
CAGCAGGCCAAGGCTCATCTGCCCTATATCAAGGCCAACATGGGCGGAACCGATGTGCTACTGGCGCTGAAGTCG
GCCATAAGCCACCGGATGGAGAGCCGGCAGTCGACACAGGTCATCCTCATCACCGACGGCGAGGTCCATAGCGAG
CCAAACGACCCGATCCTTGACTTTGTGTGGCGTACGAGAAGAGACTTGGGCGACAAGGTGCACTTCTTCAGTCTC
GGAATCGGCGATAGAGTCTCGCATCATATTGTCGAGGCTATCGCCGATCTGGGCGGCGGATACTGCGATGTCGTC
GATATAGTAACGCGTCCACGATGGGAGGGTCGATTCACCCGCATGCTTCGATCCGCCATGGAACCCGACAGCTGG
ACATGCGACATCAACCTTGGACCTGGCTACGAAAGACGGAGCTTGCTAACCTTTCGCTTCGGAGAGGACCAGCTA
GAGGACAAGTCGGTCGCTCCCGTCGTTCAAGCCCCCTATCCACTTCCGCCCCTGCATCCGTACAGCTACAAGTCT
GTCTTTTTCCTCGTCGACCTGCGCAGTGTCGAGCCTCCCAGCAACGTCTTTCTATACACGGCCACGGACGGGGCC
AAGAGGAAGATGTATCGGCTCGATATCGAAAAGGCCAGTCTCAGCGGTGGGACCATACACCACCTCGCAGCCAAG
GCCGCCCTACTCAGCCTGGAAGACGAGACGAAGAGACGAGGCTCGGAGCCTGATATTGCACGTGCTAACGCCGAG
TCGCTCGGCATGCAATACTCCGTTGTCAGCAAGTGGACGAGCTTTGTCGCTGTAGCAGACGACGAAGAGGCTCAG
GAGGTCGACCTCTACAAGAGCCCATTCCGGCAAATTGATCTGCACGAGTTGCCCAGTCTCGACGAAGATGAGGCC
TCGGTGAAATCGGAAGAAGACGGACCGGTCTACTCCGCCTCCTCGCTTCCCTCACGGCCTCCTGCTGGAAGGGAA
GGGGTTTTGAAAAGCCATGGCTGTGTCCTCCCCCTTGAAGTCATGCCTGACGCACCACCGACGCCATTTGATCCA
ACTATAAGTGTCGAATCGCCGTGTCCACCACCGCCGTGTCTGCCACCGCCGTGTCCGCCACCGGAGCCGGAACCA
GAGCTTGCCCCTCCGCGGCATTTAAGATCGGTAGGTGATGATGACGACGACGGACGTAATGGTCCACTCAATGAA
GCATCGCCTCCGTCGCCATCGACAATGCCGCTTCCGCCCCCTCCTCCGGCGTTGGAGTTGCCTGCTGAGTACCAC
TCTCACGGATACCCCAAGTCGGTGCAAGTACAGCATGACAACACGGAGAAAGACAGTGACTCTAGCTGGGAGTCT
GAAGATTCTGGAGAGCTGGCCGACTACCAACCCTCTGTTGACGGATCCATCACTTGCGAAGACGCCATGCAATGC
CAGACCAGCGACGGCTTCGTTCTCCCCGCCGTGATACGGGCGGGACTACAACAGCACTTCTGTATCGGAACTGGC
CCTTGGTTGCGCCATCTGGTACAGGAGCTTTCCCCCTCAGCCCATCGGACAGAACAGACTCTAGACGTCATGGTG
GACAGCCTCATGATGATGGTTTACTTCCGCACACACCTCGCCCAGGAGGAAGACGCCTGGTTTCTACTCATGGAC
AAGACGGAGCGTTCCATCCTACTCTCCCTCGGCTTCGAAGAGGACGAGGAAGACAAGCTGGAGGCTACATACGAC
AACCTTGACCGTACACTCGCCCACGTGCACTTCCTCGAAGCATGCAAAGACTCTTCCACCGAGCGAGCAAGCAAC
GAACAACAAGAGTCGTCTGATCAAGTGCCCAAGCACTGTCCCGTCTGCGACGACTTTTACGACACGGCGGCTGAG
AAATCCAGGACGAAAAAGGGGTTTGTCTGCTGGCATGATGATTGTTTTGACCAGCGTTTGAGAAGTCGTCGGGTT
TGGCCGAGCTGGCATGTGTTTTGGGAACACCAGATTGCTGAGGGACATGTCCTGTGTCCTGAAAAGGAGGACATT
GCGTGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail