Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3573
Gene name
Locationscaffold_281:23662..25630
Strand+
Gene length (bp)1968
Transcript length (bp)1968
Coding sequence length (bp)1965
Protein length (aa) 655

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q8IDX6|RBP2A_PLAF7 Reticulocyte-binding protein 2 homolog a OS=Plasmodium falciparum (isolate 3D7) GN=PF13_0198 PE=3 SV=1 215 302 9.0E-09
sp|Q8IDX6|RBP2A_PLAF7 Reticulocyte-binding protein 2 homolog a OS=Plasmodium falciparum (isolate 3D7) GN=PF13_0198 PE=3 SV=1 216 302 9.0E-07
sp|P33332|SEC3_YEAST Exocyst complex component SEC3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC3 PE=1 SV=1 220 343 1.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 61 0.5

Transmembrane Domains

Domain # Start End Length
1 51 73 22
2 80 102 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3573
MSGPPPPPPPHGEMPRSSGLPPGKYDIFVIPPHSAGAGFLYLPSLRPSSNSFAAGFASALILVALFQSMAPAFRA
WWESFQGLGNMGITLLVVGVGFGAWAFGRAQKDSPGHHGYKANGHPPGGGAQSTGGGFGASTSTPPPQPGSGRPP
PPPHGSSSAPPPPPPQPEDSNPRTEDEAPPAEETAPPPPRPEKAKPWSQQRPPPQPTPKSKGTWEKAREEMRRKE
EERKAKEAEQKRRDEATRRLAELRAKEAKERQEREKEKVRKEKEAREKKERELAEVQRRKLAEEQRQKLAAERLE
KEAKGGEAQATESAAKPRVGSSYAYSAVGEKTNMWPNGRPTVAPSQAGSTASKAASSSAAEKRPPAPTAKTYVGT
DDDAYSYRPQSGKRWGRRPSVSSVGGSESSWAPSHTTTRTSPPPSVRGPYSTKDPDKIVIQAVYLFMNQFAKTPA
SQLVSGVGSVTDGLILRMTTEGLFIDDDVRGVPQREWDVKAWTLKHVEAWCPPHCLKGAASVASGNNKSSAPHLL
YKMATARRNGDKDRQQLTGDEADAYLTEMLRSCRECCRLGLCKNRFGNASIQSPSGQAGEWRDKGLHVLRATIRD
QEAKRYLFVLDEAEGWKMAVGLQRLRRGTQVRQLGVSGMAPSEARSTLEMLGWAG
Coding >Ophio5|3573
ATGAGTGGCCCGCCGCCTCCGCCGCCGCCTCATGGCGAGATGCCTCGATCGTCTGGTTTGCCGCCGGGCAAATAC
GACATTTTCGTCATTCCCCCGCACTCGGCCGGTGCTGGCTTCTTGTATTTGCCGTCGTTGAGGCCGAGTTCCAAC
AGTTTCGCCGCTGGCTTTGCTTCGGCTCTCATCCTCGTCGCCCTCTTCCAGAGTATGGCCCCGGCCTTTCGAGCC
TGGTGGGAGAGCTTCCAGGGCTTGGGCAACATGGGCATCACCCTGCTCGTCGTCGGGGTCGGCTTCGGTGCCTGG
GCCTTTGGACGTGCTCAGAAGGACAGCCCGGGCCACCACGGCTACAAAGCCAACGGCCACCCCCCGGGCGGAGGA
GCGCAGTCAACTGGCGGCGGCTTCGGGGCATCGACTTCGACACCGCCACCCCAGCCTGGCTCTGGGCGTCCGCCG
CCTCCACCGCACGGTAGCAGTTCCGCCCCGCCTCCGCCTCCCCCGCAGCCAGAAGACTCGAATCCACGAACCGAA
GACGAGGCCCCGCCCGCCGAGGAGACAGCTCCGCCACCGCCCCGACCGGAAAAGGCCAAGCCTTGGTCGCAGCAG
CGGCCGCCTCCGCAGCCGACGCCAAAGTCAAAGGGCACGTGGGAAAAGGCGCGAGAGGAGATGAGAAGGAAGGAA
GAAGAACGCAAGGCCAAGGAAGCGGAGCAGAAGCGGCGCGACGAGGCCACCCGACGACTCGCCGAGCTGCGCGCC
AAGGAAGCCAAGGAGCGGCAGGAGAGAGAAAAGGAGAAAGTGCGCAAGGAGAAAGAGGCGCGGGAGAAGAAGGAG
AGAGAGCTGGCCGAAGTACAGAGAAGGAAGCTGGCCGAGGAACAGAGGCAGAAGCTGGCGGCCGAGAGACTGGAA
AAGGAGGCCAAGGGAGGCGAGGCCCAGGCTACCGAGTCGGCGGCCAAGCCCCGCGTTGGGAGCTCGTACGCCTAC
TCGGCCGTCGGCGAGAAGACCAACATGTGGCCCAACGGGAGACCGACAGTGGCCCCGTCGCAGGCCGGCAGCACG
GCGTCCAAGGCGGCGTCGTCGAGCGCCGCAGAAAAGCGACCGCCGGCGCCGACGGCCAAGACGTACGTCGGCACC
GACGACGACGCTTATTCGTACCGGCCGCAGTCGGGCAAGAGATGGGGGCGCCGGCCATCGGTCTCATCGGTAGGC
GGCTCCGAATCGTCTTGGGCTCCGTCCCACACAACAACACGGACGTCGCCGCCGCCGTCGGTTCGCGGGCCGTAC
TCGACCAAGGATCCGGACAAGATTGTCATCCAGGCCGTGTACCTGTTCATGAACCAGTTCGCCAAGACGCCGGCC
AGCCAGCTCGTGTCCGGGGTCGGATCGGTGACGGACGGACTGATCCTGCGGATGACGACCGAGGGCCTCTTCATC
GACGACGACGTGCGAGGCGTGCCGCAGCGGGAATGGGACGTCAAGGCCTGGACGCTCAAGCACGTCGAAGCCTGG
TGCCCGCCGCACTGCCTCAAGGGTGCCGCCTCGGTGGCGTCGGGAAACAACAAGAGCAGCGCGCCGCATCTGCTG
TACAAGATGGCGACGGCGCGACGAAACGGCGACAAGGACCGACAGCAGCTGACGGGCGACGAGGCGGACGCGTAC
CTGACGGAGATGCTGCGGTCGTGTCGCGAGTGCTGCCGACTGGGACTCTGCAAGAATCGCTTCGGCAACGCCAGC
ATCCAGTCGCCATCGGGTCAGGCGGGCGAGTGGCGGGACAAGGGGCTGCACGTACTGCGAGCGACGATCCGCGAC
CAAGAGGCCAAGCGCTACCTCTTCGTCCTCGACGAGGCCGAAGGCTGGAAGATGGCCGTCGGTCTGCAGCGGCTG
CGTCGAGGCACCCAGGTCCGTCAGCTGGGCGTCAGCGGCATGGCGCCGTCTGAAGCGAGGAGCACGCTGGAGATG
CTCGGATGGGCGGGG
Transcript >Ophio5|3573
ATGAGTGGCCCGCCGCCTCCGCCGCCGCCTCATGGCGAGATGCCTCGATCGTCTGGTTTGCCGCCGGGCAAATAC
GACATTTTCGTCATTCCCCCGCACTCGGCCGGTGCTGGCTTCTTGTATTTGCCGTCGTTGAGGCCGAGTTCCAAC
AGTTTCGCCGCTGGCTTTGCTTCGGCTCTCATCCTCGTCGCCCTCTTCCAGAGTATGGCCCCGGCCTTTCGAGCC
TGGTGGGAGAGCTTCCAGGGCTTGGGCAACATGGGCATCACCCTGCTCGTCGTCGGGGTCGGCTTCGGTGCCTGG
GCCTTTGGACGTGCTCAGAAGGACAGCCCGGGCCACCACGGCTACAAAGCCAACGGCCACCCCCCGGGCGGAGGA
GCGCAGTCAACTGGCGGCGGCTTCGGGGCATCGACTTCGACACCGCCACCCCAGCCTGGCTCTGGGCGTCCGCCG
CCTCCACCGCACGGTAGCAGTTCCGCCCCGCCTCCGCCTCCCCCGCAGCCAGAAGACTCGAATCCACGAACCGAA
GACGAGGCCCCGCCCGCCGAGGAGACAGCTCCGCCACCGCCCCGACCGGAAAAGGCCAAGCCTTGGTCGCAGCAG
CGGCCGCCTCCGCAGCCGACGCCAAAGTCAAAGGGCACGTGGGAAAAGGCGCGAGAGGAGATGAGAAGGAAGGAA
GAAGAACGCAAGGCCAAGGAAGCGGAGCAGAAGCGGCGCGACGAGGCCACCCGACGACTCGCCGAGCTGCGCGCC
AAGGAAGCCAAGGAGCGGCAGGAGAGAGAAAAGGAGAAAGTGCGCAAGGAGAAAGAGGCGCGGGAGAAGAAGGAG
AGAGAGCTGGCCGAAGTACAGAGAAGGAAGCTGGCCGAGGAACAGAGGCAGAAGCTGGCGGCCGAGAGACTGGAA
AAGGAGGCCAAGGGAGGCGAGGCCCAGGCTACCGAGTCGGCGGCCAAGCCCCGCGTTGGGAGCTCGTACGCCTAC
TCGGCCGTCGGCGAGAAGACCAACATGTGGCCCAACGGGAGACCGACAGTGGCCCCGTCGCAGGCCGGCAGCACG
GCGTCCAAGGCGGCGTCGTCGAGCGCCGCAGAAAAGCGACCGCCGGCGCCGACGGCCAAGACGTACGTCGGCACC
GACGACGACGCTTATTCGTACCGGCCGCAGTCGGGCAAGAGATGGGGGCGCCGGCCATCGGTCTCATCGGTAGGC
GGCTCCGAATCGTCTTGGGCTCCGTCCCACACAACAACACGGACGTCGCCGCCGCCGTCGGTTCGCGGGCCGTAC
TCGACCAAGGATCCGGACAAGATTGTCATCCAGGCCGTGTACCTGTTCATGAACCAGTTCGCCAAGACGCCGGCC
AGCCAGCTCGTGTCCGGGGTCGGATCGGTGACGGACGGACTGATCCTGCGGATGACGACCGAGGGCCTCTTCATC
GACGACGACGTGCGAGGCGTGCCGCAGCGGGAATGGGACGTCAAGGCCTGGACGCTCAAGCACGTCGAAGCCTGG
TGCCCGCCGCACTGCCTCAAGGGTGCCGCCTCGGTGGCGTCGGGAAACAACAAGAGCAGCGCGCCGCATCTGCTG
TACAAGATGGCGACGGCGCGACGAAACGGCGACAAGGACCGACAGCAGCTGACGGGCGACGAGGCGGACGCGTAC
CTGACGGAGATGCTGCGGTCGTGTCGCGAGTGCTGCCGACTGGGACTCTGCAAGAATCGCTTCGGCAACGCCAGC
ATCCAGTCGCCATCGGGTCAGGCGGGCGAGTGGCGGGACAAGGGGCTGCACGTACTGCGAGCGACGATCCGCGAC
CAAGAGGCCAAGCGCTACCTCTTCGTCCTCGACGAGGCCGAAGGCTGGAAGATGGCCGTCGGTCTGCAGCGGCTG
CGTCGAGGCACCCAGGTCCGTCAGCTGGGCGTCAGCGGCATGGCGCCGTCTGAAGCGAGGAGCACGCTGGAGATG
CTCGGATGGGCGGGGTGA
Gene >Ophio5|3573
ATGAGTGGCCCGCCGCCTCCGCCGCCGCCTCATGGCGAGATGCCTCGATCGTCTGGTTTGCCGCCGGGCAAATAC
GACATTTTCGTCATTCCCCCGCACTCGGCCGGTGCTGGCTTCTTGTATTTGCCGTCGTTGAGGCCGAGTTCCAAC
AGTTTCGCCGCTGGCTTTGCTTCGGCTCTCATCCTCGTCGCCCTCTTCCAGAGTATGGCCCCGGCCTTTCGAGCC
TGGTGGGAGAGCTTCCAGGGCTTGGGCAACATGGGCATCACCCTGCTCGTCGTCGGGGTCGGCTTCGGTGCCTGG
GCCTTTGGACGTGCTCAGAAGGACAGCCCGGGCCACCACGGCTACAAAGCCAACGGCCACCCCCCGGGCGGAGGA
GCGCAGTCAACTGGCGGCGGCTTCGGGGCATCGACTTCGACACCGCCACCCCAGCCTGGCTCTGGGCGTCCGCCG
CCTCCACCGCACGGTAGCAGTTCCGCCCCGCCTCCGCCTCCCCCGCAGCCAGAAGACTCGAATCCACGAACCGAA
GACGAGGCCCCGCCCGCCGAGGAGACAGCTCCGCCACCGCCCCGACCGGAAAAGGCCAAGCCTTGGTCGCAGCAG
CGGCCGCCTCCGCAGCCGACGCCAAAGTCAAAGGGCACGTGGGAAAAGGCGCGAGAGGAGATGAGAAGGAAGGAA
GAAGAACGCAAGGCCAAGGAAGCGGAGCAGAAGCGGCGCGACGAGGCCACCCGACGACTCGCCGAGCTGCGCGCC
AAGGAAGCCAAGGAGCGGCAGGAGAGAGAAAAGGAGAAAGTGCGCAAGGAGAAAGAGGCGCGGGAGAAGAAGGAG
AGAGAGCTGGCCGAAGTACAGAGAAGGAAGCTGGCCGAGGAACAGAGGCAGAAGCTGGCGGCCGAGAGACTGGAA
AAGGAGGCCAAGGGAGGCGAGGCCCAGGCTACCGAGTCGGCGGCCAAGCCCCGCGTTGGGAGCTCGTACGCCTAC
TCGGCCGTCGGCGAGAAGACCAACATGTGGCCCAACGGGAGACCGACAGTGGCCCCGTCGCAGGCCGGCAGCACG
GCGTCCAAGGCGGCGTCGTCGAGCGCCGCAGAAAAGCGACCGCCGGCGCCGACGGCCAAGACGTACGTCGGCACC
GACGACGACGCTTATTCGTACCGGCCGCAGTCGGGCAAGAGATGGGGGCGCCGGCCATCGGTCTCATCGGTAGGC
GGCTCCGAATCGTCTTGGGCTCCGTCCCACACAACAACACGGACGTCGCCGCCGCCGTCGGTTCGCGGGCCGTAC
TCGACCAAGGATCCGGACAAGATTGTCATCCAGGCCGTGTACCTGTTCATGAACCAGTTCGCCAAGACGCCGGCC
AGCCAGCTCGTGTCCGGGGTCGGATCGGTGACGGACGGACTGATCCTGCGGATGACGACCGAGGGCCTCTTCATC
GACGACGACGTGCGAGGCGTGCCGCAGCGGGAATGGGACGTCAAGGCCTGGACGCTCAAGCACGTCGAAGCCTGG
TGCCCGCCGCACTGCCTCAAGGGTGCCGCCTCGGTGGCGTCGGGAAACAACAAGAGCAGCGCGCCGCATCTGCTG
TACAAGATGGCGACGGCGCGACGAAACGGCGACAAGGACCGACAGCAGCTGACGGGCGACGAGGCGGACGCGTAC
CTGACGGAGATGCTGCGGTCGTGTCGCGAGTGCTGCCGACTGGGACTCTGCAAGAATCGCTTCGGCAACGCCAGC
ATCCAGTCGCCATCGGGTCAGGCGGGCGAGTGGCGGGACAAGGGGCTGCACGTACTGCGAGCGACGATCCGCGAC
CAAGAGGCCAAGCGCTACCTCTTCGTCCTCGACGAGGCCGAAGGCTGGAAGATGGCCGTCGGTCTGCAGCGGCTG
CGTCGAGGCACCCAGGTCCGTCAGCTGGGCGTCAGCGGCATGGCGCCGTCTGAAGCGAGGAGCACGCTGGAGATG
CTCGGATGGGCGGGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail