Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|357
Gene name
Locationscaffold_1081:656..2624
Strand+
Gene length (bp)1968
Transcript length (bp)1800
Coding sequence length (bp)1797
Protein length (aa) 599

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01545 Cation_efflux Cation efflux family 7.1E-51 16 436

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P20107|ZRC1_YEAST Zinc/cadmium resistance protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ZRC1 PE=1 SV=2 11 199 1.0E-46
sp|O13918|ZHF1_SCHPO Zinc homeostasis factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=zhf1 PE=2 SV=3 10 167 1.0E-42
sp|P32798|COT1_YEAST Cobalt uptake protein COT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COT1 PE=1 SV=2 10 253 3.0E-42
sp|P32798|COT1_YEAST Cobalt uptake protein COT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COT1 PE=1 SV=2 357 564 2.0E-41
sp|P20107|ZRC1_YEAST Zinc/cadmium resistance protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ZRC1 PE=1 SV=2 268 549 1.0E-37
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P20107|ZRC1_YEAST Zinc/cadmium resistance protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ZRC1 PE=1 SV=2 11 199 1.0E-46
sp|O13918|ZHF1_SCHPO Zinc homeostasis factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=zhf1 PE=2 SV=3 10 167 1.0E-42
sp|P32798|COT1_YEAST Cobalt uptake protein COT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COT1 PE=1 SV=2 10 253 3.0E-42
sp|P32798|COT1_YEAST Cobalt uptake protein COT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COT1 PE=1 SV=2 357 564 2.0E-41
sp|P20107|ZRC1_YEAST Zinc/cadmium resistance protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ZRC1 PE=1 SV=2 268 549 1.0E-37
sp|O13918|ZHF1_SCHPO Zinc homeostasis factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=zhf1 PE=2 SV=3 370 519 2.0E-34
sp|Q54T06|Y8206_DICDI Probable zinc transporter protein DDB_G0282067 OS=Dictyostelium discoideum GN=DDB_G0282067 PE=2 SV=1 370 565 2.0E-33
sp|Q3UVU3|ZNT10_MOUSE Zinc transporter 10 OS=Mus musculus GN=Slc30a10 PE=1 SV=1 11 165 2.0E-29
sp|Q3UVU3|ZNT10_MOUSE Zinc transporter 10 OS=Mus musculus GN=Slc30a10 PE=1 SV=1 371 566 2.0E-28
sp|Q6XR72|ZNT10_HUMAN Zinc transporter 10 OS=Homo sapiens GN=SLC30A10 PE=1 SV=2 11 137 3.0E-28
sp|Q6XR72|ZNT10_HUMAN Zinc transporter 10 OS=Homo sapiens GN=SLC30A10 PE=1 SV=2 334 566 9.0E-26
sp|Q62720|ZNT1_RAT Zinc transporter 1 OS=Rattus norvegicus GN=Slc30a1 PE=2 SV=1 370 565 8.0E-24
sp|Q4R6K2|ZNT1_MACFA Zinc transporter 1 OS=Macaca fascicularis GN=SLC30A1 PE=2 SV=1 370 565 9.0E-24
sp|Q60738|ZNT1_MOUSE Zinc transporter 1 OS=Mus musculus GN=Slc30a1 PE=1 SV=1 371 565 1.0E-23
sp|Q9Y6M5|ZNT1_HUMAN Zinc transporter 1 OS=Homo sapiens GN=SLC30A1 PE=1 SV=3 370 565 1.0E-23
sp|Q4R6K2|ZNT1_MACFA Zinc transporter 1 OS=Macaca fascicularis GN=SLC30A1 PE=2 SV=1 8 147 2.0E-22
sp|Q62720|ZNT1_RAT Zinc transporter 1 OS=Rattus norvegicus GN=Slc30a1 PE=2 SV=1 8 140 3.0E-22
sp|Q60738|ZNT1_MOUSE Zinc transporter 1 OS=Mus musculus GN=Slc30a1 PE=1 SV=1 8 140 3.0E-22
sp|Q9Y6M5|ZNT1_HUMAN Zinc transporter 1 OS=Homo sapiens GN=SLC30A1 PE=1 SV=3 8 147 3.0E-22
sp|Q9SI03|MTP12_ARATH Metal tolerance protein 12 OS=Arabidopsis thaliana GN=MTP12 PE=3 SV=1 11 135 2.0E-20
sp|Q8H329|MTP8_ORYSJ Metal tolerance protein 8 OS=Oryza sativa subsp. japonica GN=MTP8 PE=2 SV=2 342 518 5.0E-20
sp|Q54T06|Y8206_DICDI Probable zinc transporter protein DDB_G0282067 OS=Dictyostelium discoideum GN=DDB_G0282067 PE=2 SV=1 10 141 4.0E-19
sp|Q54QU8|Y3629_DICDI Probable zinc transporter protein DDB_G0283629 OS=Dictyostelium discoideum GN=DDB_G0283629 PE=3 SV=1 19 137 5.0E-19
sp|Q8H329|MTP8_ORYSJ Metal tolerance protein 8 OS=Oryza sativa subsp. japonica GN=MTP8 PE=2 SV=2 11 137 1.0E-18
sp|Q95QW4|CDF1_CAEEL Cation diffusion facilitator family protein 1 OS=Caenorhabditis elegans GN=cdf-1 PE=1 SV=1 10 159 2.0E-18
sp|Q54F34|Y1141_DICDI Probable zinc transporter protein DDB_G0291141 OS=Dictyostelium discoideum GN=DDB_G0291141 PE=3 SV=1 12 133 3.0E-18
sp|A7Z1S6|CZCD_BACMF Cadmium, cobalt and zinc/H(+)-K(+) antiporter OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=czcD PE=3 SV=1 10 139 5.0E-18
sp|Q8ZGY6|ZITB_YERPE Zinc transporter ZitB OS=Yersinia pestis GN=zitB PE=3 SV=1 10 137 5.0E-18
sp|Q5MNV6|ZNT7_CHICK Zinc transporter 7 OS=Gallus gallus GN=SLC30A7 PE=2 SV=1 12 169 6.0E-18
sp|Q66D85|ZITB_YERPS Zinc transporter ZitB OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=zitB PE=3 SV=1 10 137 2.0E-17
sp|Q8R4H9|ZNT5_MOUSE Zinc transporter 5 OS=Mus musculus GN=Slc30a5 PE=1 SV=1 10 154 2.0E-17
sp|O07084|CZCD_BACSU Cadmium, cobalt and zinc/H(+)-K(+) antiporter OS=Bacillus subtilis (strain 168) GN=czcD PE=1 SV=1 16 139 2.0E-17
sp|Q6DG36|ZNT5_DANRE Zinc transporter 5 OS=Danio rerio GN=slc30a5 PE=2 SV=1 12 146 2.0E-17
sp|Q5ZLF4|ZNT5_CHICK Zinc transporter 5 OS=Gallus gallus GN=SLC30A5 PE=2 SV=1 12 146 3.0E-17
sp|A4IFD7|ZNT7_BOVIN Zinc transporter 7 OS=Bos taurus GN=SLC30A7 PE=2 SV=1 12 162 3.0E-17
sp|Q8TAD4|ZNT5_HUMAN Zinc transporter 5 OS=Homo sapiens GN=SLC30A5 PE=1 SV=1 10 146 3.0E-17
sp|A5PMX1|ZNT7_DANRE Zinc transporter 7 OS=Danio rerio GN=slc30a7 PE=2 SV=1 11 137 9.0E-17
sp|Q8Z8B6|ZITB_SALTI Zinc transporter ZitB OS=Salmonella typhi GN=zitB PE=3 SV=1 10 137 1.0E-16
sp|Q28CE7|ZNT5_XENTR Zinc transporter 5 OS=Xenopus tropicalis GN=slc30a5 PE=2 SV=1 12 146 1.0E-16
sp|Q9JKN1|ZNT7_MOUSE Zinc transporter 7 OS=Mus musculus GN=Slc30a7 PE=1 SV=1 12 162 1.0E-16
sp|Q8NEW0|ZNT7_HUMAN Zinc transporter 7 OS=Homo sapiens GN=SLC30A7 PE=2 SV=1 12 162 1.0E-16
sp|Q8X400|ZITB_ECO57 Zinc transporter ZitB OS=Escherichia coli O157:H7 GN=zitB PE=3 SV=1 10 137 2.0E-16
sp|P75757|ZITB_ECOLI Zinc transporter ZitB OS=Escherichia coli (strain K12) GN=zitB PE=1 SV=1 10 137 5.0E-16
sp|Q83SA2|ZITB_SHIFL Zinc transporter ZitB OS=Shigella flexneri GN=zitB PE=3 SV=1 10 137 5.0E-16
sp|Q95QW4|CDF1_CAEEL Cation diffusion facilitator family protein 1 OS=Caenorhabditis elegans GN=cdf-1 PE=1 SV=1 370 519 6.0E-16
sp|Q5XHB4|ZNT8_XENTR Zinc transporter 8 OS=Xenopus tropicalis GN=slc30a8 PE=2 SV=1 20 164 6.0E-16
sp|Q5I020|ZNT8_XENLA Zinc transporter 8 OS=Xenopus laevis GN=slc30a8 PE=2 SV=1 10 164 7.0E-16
sp|Q5BJM8|ZNT7_RAT Zinc transporter 7 OS=Rattus norvegicus GN=Slc30a7 PE=2 SV=2 12 160 1.0E-15
sp|Q8Z8B6|ZITB_SALTI Zinc transporter ZitB OS=Salmonella typhi GN=zitB PE=3 SV=1 370 519 2.0E-15
sp|Q8ZQT3|ZITB_SALTY Zinc transporter ZitB OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=zitB PE=3 SV=1 370 519 2.0E-15
sp|Q54QU8|Y3629_DICDI Probable zinc transporter protein DDB_G0283629 OS=Dictyostelium discoideum GN=DDB_G0283629 PE=3 SV=1 334 518 4.0E-15
sp|Q8ZQT3|ZITB_SALTY Zinc transporter ZitB OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=zitB PE=3 SV=1 10 137 7.0E-15
sp|Q8BGG0|ZNT8_MOUSE Zinc transporter 8 OS=Mus musculus GN=Slc30a8 PE=2 SV=1 366 523 8.0E-15
sp|Q6NRI1|ZNT7B_XENLA Zinc transporter 7-B OS=Xenopus laevis GN=slc30a7-b PE=2 SV=1 10 137 1.0E-14
sp|Q52KD7|ZNT7A_XENLA Zinc transporter 7-A OS=Xenopus laevis GN=slc30a7-a PE=2 SV=1 10 137 2.0E-14
sp|Q6P3N9|ZNT7_XENTR Zinc transporter 7 OS=Xenopus tropicalis GN=slc30a7 PE=2 SV=1 10 137 2.0E-14
sp|Q2HJ10|ZNT2_MOUSE Zinc transporter 2 OS=Mus musculus GN=Slc30a2 PE=2 SV=1 14 152 2.0E-14
sp|Q8ZGY6|ZITB_YERPE Zinc transporter ZitB OS=Yersinia pestis GN=zitB PE=3 SV=1 370 519 3.0E-14
sp|Q66D85|ZITB_YERPS Zinc transporter ZitB OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=zitB PE=3 SV=1 370 519 4.0E-14
sp|A7Z1S6|CZCD_BACMF Cadmium, cobalt and zinc/H(+)-K(+) antiporter OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=czcD PE=3 SV=1 362 518 5.0E-14
sp|Q5XHB4|ZNT8_XENTR Zinc transporter 8 OS=Xenopus tropicalis GN=slc30a8 PE=2 SV=1 362 524 7.0E-14
sp|Q08E25|ZNT3_BOVIN Zinc transporter 3 OS=Bos taurus GN=SLC30A3 PE=2 SV=1 370 518 1.0E-13
sp|O07084|CZCD_BACSU Cadmium, cobalt and zinc/H(+)-K(+) antiporter OS=Bacillus subtilis (strain 168) GN=czcD PE=1 SV=1 362 529 2.0E-13
sp|Q8IWU4|ZNT8_HUMAN Zinc transporter 8 OS=Homo sapiens GN=SLC30A8 PE=1 SV=2 363 523 2.0E-13
sp|Q5I020|ZNT8_XENLA Zinc transporter 8 OS=Xenopus laevis GN=slc30a8 PE=2 SV=1 363 525 3.0E-13
sp|P0CE46|ZNT8_RAT Zinc transporter 8 OS=Rattus norvegicus GN=Slc30a8 PE=1 SV=1 366 523 3.0E-13
sp|Q6D7E5|ZITB_PECAS Zinc transporter ZitB OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=zitB PE=3 SV=1 370 519 3.0E-13
sp|Q5R617|ZNT3_PONAB Zinc transporter 3 OS=Pongo abelii GN=SLC30A3 PE=2 SV=1 370 518 5.0E-13
sp|Q99726|ZNT3_HUMAN Zinc transporter 3 OS=Homo sapiens GN=SLC30A3 PE=1 SV=2 370 518 5.0E-13
sp|O55174|ZNT4_RAT Zinc transporter 4 OS=Rattus norvegicus GN=Slc30a4 PE=2 SV=1 362 518 8.0E-13
sp|Q9HGQ3|CIS4_SCHPO Probable zinc transporter cis4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cis4 PE=1 SV=1 11 133 1.0E-12
sp|Q2HJ10|ZNT2_MOUSE Zinc transporter 2 OS=Mus musculus GN=Slc30a2 PE=2 SV=1 363 518 2.0E-12
sp|O35149|ZNT4_MOUSE Zinc transporter 4 OS=Mus musculus GN=Slc30a4 PE=1 SV=2 363 518 3.0E-12
sp|Q62941|ZNT2_RAT Zinc transporter 2 OS=Rattus norvegicus GN=Slc30a2 PE=2 SV=1 365 518 3.0E-12
sp|O55174|ZNT4_RAT Zinc transporter 4 OS=Rattus norvegicus GN=Slc30a4 PE=2 SV=1 13 136 4.0E-12
sp|Q9BRI3|ZNT2_HUMAN Zinc transporter 2 OS=Homo sapiens GN=SLC30A2 PE=1 SV=1 363 518 4.0E-12
sp|Q6QIX3|ZNT3_RAT Zinc transporter 3 OS=Rattus norvegicus GN=Slc30a3 PE=1 SV=1 363 518 4.0E-12
sp|Q54F34|Y1141_DICDI Probable zinc transporter protein DDB_G0291141 OS=Dictyostelium discoideum GN=DDB_G0291141 PE=3 SV=1 361 483 6.0E-12
sp|O35149|ZNT4_MOUSE Zinc transporter 4 OS=Mus musculus GN=Slc30a4 PE=1 SV=2 13 136 7.0E-12
sp|P97441|ZNT3_MOUSE Zinc transporter 3 OS=Mus musculus GN=Slc30a3 PE=1 SV=1 363 518 2.0E-11
sp|Q688R1|MTP1_ORYSJ Metal tolerance protein 1 OS=Oryza sativa subsp. japonica GN=MTP1 PE=2 SV=1 370 518 2.0E-11
sp|O14863|ZNT4_HUMAN Zinc transporter 4 OS=Homo sapiens GN=SLC30A4 PE=2 SV=2 14 136 2.0E-11
sp|Q55E98|Y9332_DICDI Probable zinc transporter protein DDB_G0269332 OS=Dictyostelium discoideum GN=DDB_G0269332 PE=3 SV=1 8 137 2.0E-11
sp|Q9ZT63|MTP1_ARATH Metal tolerance protein 1 OS=Arabidopsis thaliana GN=MTP1 PE=1 SV=2 356 518 2.0E-11
sp|Q9SI03|MTP12_ARATH Metal tolerance protein 12 OS=Arabidopsis thaliana GN=MTP12 PE=3 SV=1 376 518 7.0E-11
sp|Q62941|ZNT2_RAT Zinc transporter 2 OS=Rattus norvegicus GN=Slc30a2 PE=2 SV=1 14 134 1.0E-10
sp|O14863|ZNT4_HUMAN Zinc transporter 4 OS=Homo sapiens GN=SLC30A4 PE=2 SV=2 359 518 2.0E-10
sp|Q6DBM8|MTPB_ARATH Metal tolerance protein B OS=Arabidopsis thaliana GN=MTPB PE=2 SV=1 363 518 2.0E-10
sp|P13512|CZCD_CUPMC Metal cation efflux system protein CzcD OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=czcD PE=1 SV=2 365 520 2.0E-10
sp|P94178|CZCD_ALCSC Cation efflux system protein CzcD OS=Alcaligenes sp. (strain CT14) GN=czcD PE=3 SV=1 365 520 2.0E-10
sp|Q688R1|MTP1_ORYSJ Metal tolerance protein 1 OS=Oryza sativa subsp. japonica GN=MTP1 PE=2 SV=1 14 137 8.0E-10
sp|Q9ZT63|MTP1_ARATH Metal tolerance protein 1 OS=Arabidopsis thaliana GN=MTP1 PE=1 SV=2 14 137 8.0E-10
sp|Q03455|MSC2_YEAST Probable zinc transporter MSC2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSC2 PE=1 SV=2 2 110 8.0E-10
sp|Q6D7E5|ZITB_PECAS Zinc transporter ZitB OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=zitB PE=3 SV=1 11 137 1.0E-09
sp|Q5R617|ZNT3_PONAB Zinc transporter 3 OS=Pongo abelii GN=SLC30A3 PE=2 SV=1 25 152 1.0E-09
sp|Q99726|ZNT3_HUMAN Zinc transporter 3 OS=Homo sapiens GN=SLC30A3 PE=1 SV=2 25 152 1.0E-09
sp|Q9M271|MTPA1_ARATH Metal tolerance protein A1 OS=Arabidopsis thaliana GN=MTPA1 PE=2 SV=1 378 518 1.0E-09
sp|Q8R4H9|ZNT5_MOUSE Zinc transporter 5 OS=Mus musculus GN=Slc30a5 PE=1 SV=1 372 518 2.0E-09
sp|Q6DG36|ZNT5_DANRE Zinc transporter 5 OS=Danio rerio GN=slc30a5 PE=2 SV=1 373 547 2.0E-09
sp|Q08E25|ZNT3_BOVIN Zinc transporter 3 OS=Bos taurus GN=SLC30A3 PE=2 SV=1 25 152 2.0E-09
sp|Q8TAD4|ZNT5_HUMAN Zinc transporter 5 OS=Homo sapiens GN=SLC30A5 PE=1 SV=1 373 518 5.0E-09
sp|Q8NEW0|ZNT7_HUMAN Zinc transporter 7 OS=Homo sapiens GN=SLC30A7 PE=2 SV=1 346 483 7.0E-09
sp|Q5MNV6|ZNT7_CHICK Zinc transporter 7 OS=Gallus gallus GN=SLC30A7 PE=2 SV=1 373 483 8.0E-09
sp|Q5ZLF4|ZNT5_CHICK Zinc transporter 5 OS=Gallus gallus GN=SLC30A5 PE=2 SV=1 370 545 1.0E-08
sp|A4IFD7|ZNT7_BOVIN Zinc transporter 7 OS=Bos taurus GN=SLC30A7 PE=2 SV=1 346 483 1.0E-08
sp|Q28CE7|ZNT5_XENTR Zinc transporter 5 OS=Xenopus tropicalis GN=slc30a5 PE=2 SV=1 369 545 1.0E-08
sp|Q6QIX3|ZNT3_RAT Zinc transporter 3 OS=Rattus norvegicus GN=Slc30a3 PE=1 SV=1 20 156 1.0E-08
sp|Q9LXS1|MTPA2_ARATH Metal tolerance protein A2 OS=Arabidopsis thaliana GN=MTPA2 PE=2 SV=2 370 482 1.0E-08
sp|Q6ICY4|MTPC2_ARATH Metal tolerance protein C2 OS=Arabidopsis thaliana GN=MTPC2 PE=2 SV=1 14 157 1.0E-08
sp|Q8X400|ZITB_ECO57 Zinc transporter ZitB OS=Escherichia coli O157:H7 GN=zitB PE=3 SV=1 364 519 4.0E-08
sp|P75757|ZITB_ECOLI Zinc transporter ZitB OS=Escherichia coli (strain K12) GN=zitB PE=1 SV=1 364 519 4.0E-08
sp|Q8IWU4|ZNT8_HUMAN Zinc transporter 8 OS=Homo sapiens GN=SLC30A8 PE=1 SV=2 3 148 4.0E-08
sp|Q9JKN1|ZNT7_MOUSE Zinc transporter 7 OS=Mus musculus GN=Slc30a7 PE=1 SV=1 373 483 5.0E-08
sp|P97441|ZNT3_MOUSE Zinc transporter 3 OS=Mus musculus GN=Slc30a3 PE=1 SV=1 25 156 5.0E-08
sp|Q6NRI1|ZNT7B_XENLA Zinc transporter 7-B OS=Xenopus laevis GN=slc30a7-b PE=2 SV=1 373 482 6.0E-08
sp|Q5BJM8|ZNT7_RAT Zinc transporter 7 OS=Rattus norvegicus GN=Slc30a7 PE=2 SV=2 373 483 9.0E-08
sp|Q6P3N9|ZNT7_XENTR Zinc transporter 7 OS=Xenopus tropicalis GN=slc30a7 PE=2 SV=1 373 482 9.0E-08
sp|P0CE46|ZNT8_RAT Zinc transporter 8 OS=Rattus norvegicus GN=Slc30a8 PE=1 SV=1 25 148 9.0E-08
sp|A5PMX1|ZNT7_DANRE Zinc transporter 7 OS=Danio rerio GN=slc30a7 PE=2 SV=1 373 483 1.0E-07
sp|Q83SA2|ZITB_SHIFL Zinc transporter ZitB OS=Shigella flexneri GN=zitB PE=3 SV=1 364 519 1.0E-07
sp|Q8BGG0|ZNT8_MOUSE Zinc transporter 8 OS=Mus musculus GN=Slc30a8 PE=2 SV=1 25 148 4.0E-07
sp|Q9HGQ3|CIS4_SCHPO Probable zinc transporter cis4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cis4 PE=1 SV=1 376 483 4.0E-07
sp|P13512|CZCD_CUPMC Metal cation efflux system protein CzcD OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=czcD PE=1 SV=2 15 137 4.0E-07
sp|P94178|CZCD_ALCSC Cation efflux system protein CzcD OS=Alcaligenes sp. (strain CT14) GN=czcD PE=3 SV=1 15 137 4.0E-07
sp|Q6DBM8|MTPB_ARATH Metal tolerance protein B OS=Arabidopsis thaliana GN=MTPB PE=2 SV=1 12 138 8.0E-07
sp|Q52KD7|ZNT7A_XENLA Zinc transporter 7-A OS=Xenopus laevis GN=slc30a7-a PE=2 SV=1 373 482 1.0E-06
sp|Q9M271|MTPA1_ARATH Metal tolerance protein A1 OS=Arabidopsis thaliana GN=MTPA1 PE=2 SV=1 18 137 1.0E-06
sp|Q9LXS1|MTPA2_ARATH Metal tolerance protein A2 OS=Arabidopsis thaliana GN=MTPA2 PE=2 SV=2 14 131 1.0E-06
sp|P30540|YGLB_GEOSE Uncharacterized protein in glgB 5'region (Fragment) OS=Geobacillus stearothermophilus PE=4 SV=1 10 99 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0006812 cation transport Yes
GO:0008324 cation transmembrane transporter activity Yes
GO:0015075 ion transmembrane transporter activity No
GO:0006810 transport No
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0005215 transporter activity No
GO:0008150 biological_process No
GO:0031224 intrinsic component of membrane No
GO:0110165 cellular anatomical entity No
GO:0022857 transmembrane transporter activity No
GO:0051234 establishment of localization No
GO:0009987 cellular process No
GO:0006811 ion transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 46 0.5

Transmembrane Domains

Domain # Start End Length
1 17 36 19
2 46 65 19
3 86 108 22
4 118 140 22
5 377 399 22
6 414 436 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|357
MSGSSKWAWSKSTRIKVMLVIDTAFFLVELIAGFLAHSLALTADAFHMLNDIISLFIGLWAVVAAQKATTDEFTF
GWVRAEILGAFFNAVFLIALCVSIVLEALTRFVEPPDISNPKLILIVGCAGLFSNLLGFVVLGGHGHGHSHDDHG
EEGHDHSHEHPHQDDVEPGRVIADIRGDVANQDGPVNDVLPEVVARRVTANTAADRSATDGSETPRRIRFGDETS
GHEETSARGGRAAAQPSGRRRRQSSKSGHSRFASIEDMSIHPASLRQDILAVSLAAASPNPAGAAGGDESPLADS
DAEANEEMPLLRGAKSNGGAVQDKSHAACSGAASKRRRSRRDSSVHANHHHTKPRKAGTKVGGHSHNHADMGMNA
MMLHVLGDALGNVGVIITALIIWLTDWPGKEYADPAVSLVITAIILKTSVPLTLATARVLLQATPENISIQEIRH
DIERLPGVVSCHHVHVWQLSDTKVVASLHLQVSFPINTHSGEKYMQLARRARKCLHAYGIHSATIQPEFCLDQTH
QHEQEAAAMTLDGVAASGDGACDSACLLSCVDDCKAQGCCPGQDTSSQASSTRRGSDSSHGDAGMSVTGHRPTC
Coding >Ophio5|357
ATGTCCGGCTCTTCGAAATGGGCGTGGTCCAAGAGCACCCGTATCAAGGTGATGCTCGTCATCGACACCGCCTTC
TTCCTCGTCGAGCTCATCGCTGGATTCCTCGCACACTCCTTGGCCCTGACGGCTGATGCGTTCCACATGTTAAAC
GACATCATCTCTCTGTTCATTGGGTTGTGGGCAGTTGTCGCCGCACAAAAGGCAACGACGGATGAGTTTACGTTT
GGGTGGGTGCGCGCCGAAATCCTTGGTGCCTTTTTCAACGCAGTTTTCCTCATAGCCCTCTGTGTCTCCATTGTT
CTAGAGGCCCTCACCCGATTCGTCGAGCCACCCGACATCAGCAACCCGAAACTCATCCTCATTGTTGGCTGCGCC
GGCCTCTTCTCCAATCTGCTGGGCTTCGTTGTTCTCGGCGGCCACGGCCACGGACATTCCCACGACGACCATGGC
GAGGAGGGTCATGACCACTCCCACGAGCATCCCCACCAGGACGACGTTGAGCCTGGGAGAGTTATAGCCGACATC
AGAGGCGACGTTGCCAACCAGGACGGACCCGTCAACGACGTTTTGCCCGAGGTCGTCGCCAGGCGGGTCACAGCA
AACACTGCCGCCGACCGGTCTGCGACGGACGGCTCTGAGACACCGCGCCGTATACGATTCGGAGACGAGACATCC
GGCCACGAGGAGACCAGTGCTCGAGGCGGCCGTGCGGCAGCGCAACCCAGTGGCCGCCGGCGTCGGCAATCCAGC
AAGAGTGGGCATTCGCGCTTCGCCAGTATCGAAGACATGAGCATTCATCCGGCAAGCCTACGGCAGGACATCCTC
GCCGTCAGCCTTGCCGCCGCCTCTCCCAATCCGGCGGGAGCAGCTGGTGGCGACGAATCGCCCCTGGCGGACTCG
GATGCCGAGGCAAACGAAGAGATGCCTCTGCTGAGAGGCGCCAAGAGTAACGGGGGAGCGGTCCAGGACAAGTCG
CACGCCGCCTGTTCCGGCGCCGCCTCGAAACGGCGCAGGTCTCGCCGGGACTCGAGCGTGCACGCCAATCACCAC
CACACGAAGCCCCGCAAGGCCGGCACCAAGGTCGGTGGCCACAGCCATAACCACGCTGACATGGGTATGAACGCC
ATGATGTTACACGTCCTGGGCGACGCGCTGGGCAACGTGGGCGTCATCATCACGGCCCTCATCATCTGGCTCACC
GACTGGCCGGGTAAGGAGTATGCCGACCCGGCCGTTTCCCTCGTCATCACGGCCATCATTCTCAAGACGTCGGTT
CCCCTGACGCTGGCGACGGCACGGGTGCTGCTGCAGGCGACGCCGGAGAACATCAGCATTCAGGAGATTCGACAC
GACATTGAGAGGCTGCCCGGAGTCGTCAGCTGCCACCACGTTCACGTCTGGCAGCTGTCGGACACCAAGGTGGTG
GCGAGCCTACACCTTCAAGTTTCGTTCCCTATCAACACGCACAGCGGAGAGAAGTACATGCAGTTGGCCAGGCGG
GCTCGCAAATGCCTCCACGCGTACGGAATTCACAGCGCCACGATCCAGCCCGAATTCTGCCTGGACCAGACACAC
CAGCACGAACAGGAGGCGGCTGCCATGACGCTGGACGGCGTGGCGGCCAGCGGTGACGGCGCCTGCGACAGCGCG
TGCCTGCTATCGTGCGTAGACGATTGCAAGGCGCAGGGGTGCTGCCCCGGTCAGGACACATCGTCCCAGGCTTCC
TCGACACGTCGGGGCAGCGATTCTTCGCACGGCGATGCCGGGATGTCCGTCACTGGTCATAGGCCGACTTGT
Transcript >Ophio5|357
ATGTCCGGCTCTTCGAAATGGGCGTGGTCCAAGAGCACCCGTATCAAGGTGATGCTCGTCATCGACACCGCCTTC
TTCCTCGTCGAGCTCATCGCTGGATTCCTCGCACACTCCTTGGCCCTGACGGCTGATGCGTTCCACATGTTAAAC
GACATCATCTCTCTGTTCATTGGGTTGTGGGCAGTTGTCGCCGCACAAAAGGCAACGACGGATGAGTTTACGTTT
GGGTGGGTGCGCGCCGAAATCCTTGGTGCCTTTTTCAACGCAGTTTTCCTCATAGCCCTCTGTGTCTCCATTGTT
CTAGAGGCCCTCACCCGATTCGTCGAGCCACCCGACATCAGCAACCCGAAACTCATCCTCATTGTTGGCTGCGCC
GGCCTCTTCTCCAATCTGCTGGGCTTCGTTGTTCTCGGCGGCCACGGCCACGGACATTCCCACGACGACCATGGC
GAGGAGGGTCATGACCACTCCCACGAGCATCCCCACCAGGACGACGTTGAGCCTGGGAGAGTTATAGCCGACATC
AGAGGCGACGTTGCCAACCAGGACGGACCCGTCAACGACGTTTTGCCCGAGGTCGTCGCCAGGCGGGTCACAGCA
AACACTGCCGCCGACCGGTCTGCGACGGACGGCTCTGAGACACCGCGCCGTATACGATTCGGAGACGAGACATCC
GGCCACGAGGAGACCAGTGCTCGAGGCGGCCGTGCGGCAGCGCAACCCAGTGGCCGCCGGCGTCGGCAATCCAGC
AAGAGTGGGCATTCGCGCTTCGCCAGTATCGAAGACATGAGCATTCATCCGGCAAGCCTACGGCAGGACATCCTC
GCCGTCAGCCTTGCCGCCGCCTCTCCCAATCCGGCGGGAGCAGCTGGTGGCGACGAATCGCCCCTGGCGGACTCG
GATGCCGAGGCAAACGAAGAGATGCCTCTGCTGAGAGGCGCCAAGAGTAACGGGGGAGCGGTCCAGGACAAGTCG
CACGCCGCCTGTTCCGGCGCCGCCTCGAAACGGCGCAGGTCTCGCCGGGACTCGAGCGTGCACGCCAATCACCAC
CACACGAAGCCCCGCAAGGCCGGCACCAAGGTCGGTGGCCACAGCCATAACCACGCTGACATGGGTATGAACGCC
ATGATGTTACACGTCCTGGGCGACGCGCTGGGCAACGTGGGCGTCATCATCACGGCCCTCATCATCTGGCTCACC
GACTGGCCGGGTAAGGAGTATGCCGACCCGGCCGTTTCCCTCGTCATCACGGCCATCATTCTCAAGACGTCGGTT
CCCCTGACGCTGGCGACGGCACGGGTGCTGCTGCAGGCGACGCCGGAGAACATCAGCATTCAGGAGATTCGACAC
GACATTGAGAGGCTGCCCGGAGTCGTCAGCTGCCACCACGTTCACGTCTGGCAGCTGTCGGACACCAAGGTGGTG
GCGAGCCTACACCTTCAAGTTTCGTTCCCTATCAACACGCACAGCGGAGAGAAGTACATGCAGTTGGCCAGGCGG
GCTCGCAAATGCCTCCACGCGTACGGAATTCACAGCGCCACGATCCAGCCCGAATTCTGCCTGGACCAGACACAC
CAGCACGAACAGGAGGCGGCTGCCATGACGCTGGACGGCGTGGCGGCCAGCGGTGACGGCGCCTGCGACAGCGCG
TGCCTGCTATCGTGCGTAGACGATTGCAAGGCGCAGGGGTGCTGCCCCGGTCAGGACACATCGTCCCAGGCTTCC
TCGACACGTCGGGGCAGCGATTCTTCGCACGGCGATGCCGGGATGTCCGTCACTGGTCATAGGCCGACTTGTTAG
Gene >Ophio5|357
ATGTCCGGCTCTTCGAAATGGGCGTGGTCCAAGAGCACCCGTATCAAGGTGATGCTCGTCATCGACACCGCCTTC
TTCCTCGTCGAGCTCATCGCTGGATTCCTCGCACACTCCTTGGCCCTGACGGCTGATGCGTTCCACATGGTATGT
CCCGTCCACCGACTGTTTTCGATCTTCGGTCTCTGCGTCGCAGAACCCCCATCCGCTCTTCACTCGTCGCGCCGA
CTGACCCGTTGTCTTGCTTTAGTTAAACGACATCATCTCTCTGTTCATTGGGTTGTGGGCAGTTGTCGCCGCACA
AAAGGCAACGACGGATGAGTTTACGTTTGGGGTATGTTTCGTGATACCTCCCTGCCTTGCTTCGACCCGAGCTTA
CCGCCTATTTCCCTCCGTCAGTGGGTGCGCGCCGAAATCCTTGGTGCCTTTTTCAACGCAGTTTTCCTCATAGCC
CTCTGTGTCTCCATTGTTCTAGAGGCCCTCACCCGATTCGTCGAGCCACCCGACATCAGCAACCCGAAACTCATC
CTCATTGTTGGCTGCGCCGGCCTCTTCTCCAATCTGCTGGGCTTCGTTGTTCTCGGCGGCCACGGCCACGGACAT
TCCCACGACGACCATGGCGAGGAGGGTCATGACCACTCCCACGAGCATCCCCACCAGGACGACGTTGAGCCTGGG
AGAGTTATAGCCGACATCAGAGGCGACGTTGCCAACCAGGACGGACCCGTCAACGACGTTTTGCCCGAGGTCGTC
GCCAGGCGGGTCACAGCAAACACTGCCGCCGACCGGTCTGCGACGGACGGCTCTGAGACACCGCGCCGTATACGA
TTCGGAGACGAGACATCCGGCCACGAGGAGACCAGTGCTCGAGGCGGCCGTGCGGCAGCGCAACCCAGTGGCCGC
CGGCGTCGGCAATCCAGCAAGAGTGGGCATTCGCGCTTCGCCAGTATCGAAGACATGAGCATTCATCCGGCAAGC
CTACGGCAGGACATCCTCGCCGTCAGCCTTGCCGCCGCCTCTCCCAATCCGGCGGGAGCAGCTGGTGGCGACGAA
TCGCCCCTGGCGGACTCGGATGCCGAGGCAAACGAAGAGATGCCTCTGCTGAGAGGCGCCAAGAGTAACGGGGGA
GCGGTCCAGGACAAGTCGCACGCCGCCTGTTCCGGCGCCGCCTCGAAACGGCGCAGGTCTCGCCGGGACTCGAGC
GTGCACGCCAATCACCACCACACGAAGCCCCGCAAGGCCGGCACCAAGGTCGGTGGCCACAGCCATAACCACGCT
GACATGGGTATGAACGCCATGATGTTACACGTCCTGGGCGACGCGCTGGGCAACGTGGGCGTCATCATCACGGCC
CTCATCATCTGGCTCACCGACTGGCCGGGTAAGGAGTATGCCGACCCGGCCGTTTCCCTCGTCATCACGGCCATC
ATTCTCAAGACGTCGGTTCCCCTGACGCTGGCGACGGCACGGGTGCTGCTGCAGGCGACGCCGGAGAACATCAGC
ATTCAGGAGATTCGACACGACATTGAGAGGCTGCCCGGAGTCGTCAGCTGCCACCACGTTCACGTCTGGCAGCTG
TCGGACACCAAGGTGGTGGCGAGCCTACACCTTCAAGTTTCGTTCCCTATCAACACGCACAGCGGAGAGAAGTAC
ATGCAGTTGGCCAGGCGGGCTCGCAAATGCCTCCACGCGTACGGAATTCACAGCGCCACGATCCAGCCCGAATTC
TGCCTGGACCAGACACACCAGCACGAACAGGAGGCGGCTGCCATGACGCTGGACGGCGTGGCGGCCAGCGGTGAC
GGCGCCTGCGACAGCGCGTGCCTGCTATCGTGCGTAGACGATTGCAAGGCGCAGGGGTGCTGCCCCGGTCAGGAC
ACATCGTCCCAGGCTTCCTCGACACGTCGGGGCAGCGATTCTTCGCACGGCGATGCCGGGATGTCCGTCACTGGT
CATAGGCCGACTTGTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail