Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|355
Gene name
Locationscaffold_108:39145..42832
Strand+
Gene length (bp)3687
Transcript length (bp)3687
Coding sequence length (bp)3684
Protein length (aa) 1228

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12768 Rax2 Cortical protein marker for cell polarity 4.0E-46 1003 1149

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q12465|RAX2_YEAST Bud site selection protein RAX2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAX2 PE=1 SV=1 16 541 2.0E-44
sp|O14239|RAX2_SCHPO Polarized growth protein rax2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rax2 PE=1 SV=1 48 791 2.0E-42
sp|O14239|RAX2_SCHPO Polarized growth protein rax2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rax2 PE=1 SV=1 901 1186 3.0E-08

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 31 0.45

Transmembrane Domains

Domain # Start End Length
1 1157 1179 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|355
MRLPFRRCRVVRPPDFLLALAAFVPSLTSALDFKPAPAANLDLSSLGEVVIAGDFSGISLYQYHGQTSTDLSTNG
SQSLLARLPNGVLSPVAATDASIQSMCALRRKNGDLDSVVLGGNFTSLDGIQSTAVALFNPTTSEFKPVSGLEGQ
VSALYCDQERELVYIGGRFHGANSTNALAWSSAKGLIDLPFAGFNGPVDAITKSSNGHIIFGGNFTGLGNASTPS
RPDEQVINLSIANTTATNSASIAGFSDPKSLACSDGSDGPGRTWLLADKTPGTWAADFGYVFQPTKLRLWNTRHD
GRGTKTFRFLAFPINGIMNLTYVDPATGRNATCTSECPLSHDADLAFQDFHFVNRVGMNSFQIAISDWYGDGAGL
AGIQLFHDDIYAYAIHDFNEPTCGGNKFPSKASATGPWEHSPSVQSSSDYLTANLTSSSPRQLPSIIFYPSIRES
GNYSVNMYTPGCMPDRSCLTRGRVNVTGTMSSRTTNAGFSATLFQTNNYDKYDQIYFGYVEKTSDSFQPSVTITP
LAGQDMPLTVVAQRVGFNLVNSTGGLNGLFDFNPDNNTVDVTKFEQSPINKLGSGFKRSSGVSSLAASGDIVYVG
GDFRSDGRANVVAIGGTNNDVQSLDGGLNGRVLDMHLEDTKLYVGGDFTDKQTATQDGLNHVAVFDTRASTWSAL
GAGVDGRVQHVVPLVINMTADAMETAIALSGTFAECRGFGDNRPIPVDGFAVWVPSKNNWLQNVDGSRPAYNGIL
TAAVVDLPNNDKLFAGSMESAQVGANGAARLGEKGLSSLASIHLMAAPPTPTRSRRDELSNGARGVVAGTFYDNG
DANVTVLAGHFTARTTDGSTIDNLVLIDGGKSGAVSGLGPGVAAGSAFTTVAMRGSVLYAGGQVSGTVADRPIGG
IVAYDVKAKSFSNQPAPVAGGEGTVSAITVRPNSAEVYVAGSFEKAGALDCPAVCLYNADLDQWMQPGNGLSGEV
SCLMWSSDSTLIAGGDMRANGTDKQYLTAFSVKRQAWTSFPGAEGIPGPVQVMTPASSDGNQVWIAGKSAQDGSV
FLMKFDGSTWKKAPQALPAKTVLRSLQVFTLTKSHGKTDMLEDKQGLMLTGSMDLPGVGPVSAVLYNGTDYLPYS
LTTHSGPGAGSVGKIFTQKDDFFTSDRGHMPLVFVVLIGLAIALGLILLMVLAGIVLDRLRKKREGYTRAPTSMN
DRGSGIHRIPPSELLESLGKSRPGAPHV
Coding >Ophio5|355
ATGCGGCTACCCTTTCGACGGTGTCGCGTCGTGCGGCCGCCCGACTTTCTGCTGGCCCTGGCAGCTTTCGTGCCC
TCGCTAACCAGCGCTCTCGACTTCAAACCGGCGCCCGCCGCCAACCTCGACCTCTCCAGCCTGGGTGAGGTGGTC
ATCGCCGGTGACTTCAGCGGCATCTCTCTTTACCAGTATCACGGCCAGACCTCCACCGATCTCAGCACAAATGGC
AGCCAGTCCCTCCTCGCCCGCCTGCCCAACGGCGTCCTCTCTCCCGTGGCCGCTACCGATGCCTCGATACAGTCC
ATGTGCGCCTTGCGGCGAAAGAACGGCGACCTCGACAGCGTTGTTCTCGGAGGAAACTTCACCAGCCTCGACGGC
ATCCAGTCCACTGCCGTCGCCCTCTTCAACCCTACCACGTCCGAGTTCAAGCCCGTCAGTGGCCTCGAGGGCCAA
GTTAGCGCCCTCTACTGCGATCAGGAGCGGGAGCTCGTCTACATCGGCGGACGCTTTCACGGTGCAAACTCCACC
AATGCCCTCGCCTGGTCGAGCGCCAAGGGCTTGATTGACTTGCCCTTTGCTGGTTTCAACGGCCCCGTCGACGCC
ATCACCAAATCCTCAAACGGTCACATCATTTTCGGAGGCAATTTCACTGGCTTGGGCAACGCAAGTACGCCCAGT
CGGCCCGACGAGCAGGTCATCAATCTGTCCATCGCCAACACCACCGCCACCAATTCCGCCTCCATAGCTGGATTC
TCCGACCCAAAGTCACTGGCCTGCTCTGATGGCTCTGACGGCCCGGGCCGGACCTGGCTCCTGGCCGACAAGACG
CCTGGAACCTGGGCCGCCGACTTCGGTTACGTCTTTCAACCCACCAAGCTCAGGCTGTGGAACACGCGCCACGAT
GGGCGCGGAACCAAGACGTTCCGCTTTCTTGCCTTTCCTATCAACGGAATCATGAATCTGACCTACGTCGATCCT
GCCACCGGGCGAAATGCGACGTGCACGAGCGAATGCCCCTTGAGCCACGATGCCGACCTTGCGTTTCAAGACTTT
CACTTCGTCAACCGAGTGGGCATGAACAGTTTTCAAATCGCCATTTCTGACTGGTACGGCGACGGCGCAGGTTTG
GCCGGCATCCAGCTGTTCCACGACGACATCTACGCCTACGCCATCCACGACTTCAACGAACCAACATGCGGAGGC
AATAAGTTTCCGTCCAAGGCTTCCGCCACCGGGCCGTGGGAACATTCCCCGTCGGTGCAAAGCAGCTCGGATTAC
TTGACGGCAAACCTGACGTCTTCCTCGCCACGTCAGTTGCCTTCCATCATCTTCTACCCCAGCATTCGCGAGTCT
GGCAACTATTCCGTCAACATGTACACGCCTGGCTGCATGCCTGATAGGTCGTGCCTGACGCGCGGCCGCGTCAAC
GTGACGGGCACCATGTCTTCCAGGACCACCAACGCCGGCTTCTCCGCGACTCTTTTCCAGACCAACAACTATGAC
AAATACGACCAGATCTACTTTGGCTACGTGGAGAAGACGTCTGACAGCTTCCAGCCCAGTGTCACCATCACCCCG
CTTGCTGGCCAGGACATGCCACTGACGGTGGTGGCCCAGAGAGTTGGCTTTAACCTCGTCAACTCGACTGGCGGG
CTCAATGGACTCTTCGACTTCAATCCGGACAACAACACGGTCGACGTAACCAAATTCGAGCAGTCACCCATCAAC
AAACTCGGCTCCGGCTTCAAGCGCAGTTCCGGCGTATCGTCGCTCGCCGCCTCGGGTGACATCGTCTATGTCGGT
GGCGACTTCCGCTCAGACGGCCGCGCGAACGTGGTTGCCATCGGAGGGACAAACAACGATGTTCAATCCCTTGAT
GGGGGCCTCAACGGCCGGGTCCTCGACATGCACCTCGAAGACACCAAGCTCTACGTCGGAGGCGACTTCACCGAC
AAACAAACGGCAACTCAGGATGGCCTGAACCACGTTGCTGTCTTCGACACGCGAGCCAGCACGTGGAGCGCGCTT
GGTGCCGGTGTGGACGGACGAGTGCAACACGTGGTGCCTTTGGTCATCAACATGACGGCAGACGCGATGGAGACG
GCCATTGCTTTGTCCGGAACCTTTGCTGAGTGCAGGGGTTTCGGTGACAATCGACCGATTCCCGTCGACGGTTTC
GCCGTCTGGGTCCCGTCGAAGAACAACTGGTTGCAGAACGTCGACGGTTCTCGTCCCGCCTACAATGGCATCCTT
ACCGCCGCCGTCGTTGATCTGCCCAACAACGACAAGCTCTTTGCCGGCTCGATGGAATCGGCGCAGGTGGGTGCA
AACGGCGCCGCTAGGTTGGGCGAGAAGGGCCTTAGCAGCCTCGCGTCTATCCATCTAATGGCTGCACCACCGACG
CCTACGAGGAGCCGCAGGGATGAGCTCTCGAACGGGGCTCGCGGCGTGGTCGCAGGCACCTTCTACGACAACGGC
GACGCCAACGTAACGGTGCTGGCCGGGCACTTTACGGCCCGGACGACGGACGGTTCGACCATTGACAACCTGGTG
CTGATAGACGGGGGCAAGAGCGGCGCCGTCAGCGGGCTGGGACCCGGGGTAGCCGCAGGATCGGCCTTCACGACG
GTGGCGATGCGCGGCAGCGTGCTATATGCCGGCGGCCAGGTCAGCGGCACGGTAGCGGACCGTCCGATCGGCGGC
ATCGTCGCCTACGACGTCAAGGCTAAGTCTTTCAGCAATCAGCCGGCTCCCGTGGCCGGCGGCGAGGGCACCGTA
TCGGCTATCACCGTCCGGCCCAACTCGGCCGAGGTCTACGTTGCAGGCTCATTCGAGAAGGCGGGCGCGCTTGAC
TGCCCTGCCGTATGCCTCTATAACGCGGACTTGGATCAGTGGATGCAGCCGGGCAACGGTCTCTCGGGTGAGGTG
TCGTGCCTCATGTGGTCGAGCGACTCTACGCTCATCGCCGGCGGCGACATGCGCGCCAACGGAACCGACAAGCAG
TACTTGACGGCTTTCAGCGTCAAGAGGCAAGCGTGGACGAGCTTCCCGGGGGCCGAGGGCATCCCCGGCCCCGTG
CAGGTGATGACGCCGGCGTCGAGCGACGGCAACCAAGTGTGGATTGCCGGCAAGTCAGCCCAGGACGGGTCGGTC
TTTCTCATGAAGTTCGACGGCAGCACATGGAAGAAGGCACCGCAAGCGCTGCCAGCCAAGACGGTGTTGCGCAGT
CTTCAAGTCTTTACGCTGACGAAGAGCCACGGCAAGACGGACATGCTCGAAGACAAGCAAGGTCTGATGCTCACC
GGCTCCATGGACCTGCCCGGCGTCGGGCCGGTCTCGGCGGTGTTATACAACGGCACGGACTACCTGCCGTACAGC
CTCACGACGCACTCGGGTCCCGGGGCGGGCAGCGTGGGCAAGATCTTCACGCAAAAGGACGACTTCTTCACGTCA
GACAGGGGCCACATGCCGCTCGTTTTCGTGGTGCTGATCGGACTGGCGATTGCGCTGGGCCTCATCCTGCTGATG
GTTCTGGCGGGCATCGTACTGGACCGGCTACGGAAGAAGCGCGAGGGCTACACACGGGCGCCGACATCGATGAAC
GACCGGGGCAGCGGCATCCATCGGATACCGCCGAGCGAGCTGCTCGAGTCGCTGGGCAAGAGCCGGCCCGGCGCG
CCGCACGTG
Transcript >Ophio5|355
ATGCGGCTACCCTTTCGACGGTGTCGCGTCGTGCGGCCGCCCGACTTTCTGCTGGCCCTGGCAGCTTTCGTGCCC
TCGCTAACCAGCGCTCTCGACTTCAAACCGGCGCCCGCCGCCAACCTCGACCTCTCCAGCCTGGGTGAGGTGGTC
ATCGCCGGTGACTTCAGCGGCATCTCTCTTTACCAGTATCACGGCCAGACCTCCACCGATCTCAGCACAAATGGC
AGCCAGTCCCTCCTCGCCCGCCTGCCCAACGGCGTCCTCTCTCCCGTGGCCGCTACCGATGCCTCGATACAGTCC
ATGTGCGCCTTGCGGCGAAAGAACGGCGACCTCGACAGCGTTGTTCTCGGAGGAAACTTCACCAGCCTCGACGGC
ATCCAGTCCACTGCCGTCGCCCTCTTCAACCCTACCACGTCCGAGTTCAAGCCCGTCAGTGGCCTCGAGGGCCAA
GTTAGCGCCCTCTACTGCGATCAGGAGCGGGAGCTCGTCTACATCGGCGGACGCTTTCACGGTGCAAACTCCACC
AATGCCCTCGCCTGGTCGAGCGCCAAGGGCTTGATTGACTTGCCCTTTGCTGGTTTCAACGGCCCCGTCGACGCC
ATCACCAAATCCTCAAACGGTCACATCATTTTCGGAGGCAATTTCACTGGCTTGGGCAACGCAAGTACGCCCAGT
CGGCCCGACGAGCAGGTCATCAATCTGTCCATCGCCAACACCACCGCCACCAATTCCGCCTCCATAGCTGGATTC
TCCGACCCAAAGTCACTGGCCTGCTCTGATGGCTCTGACGGCCCGGGCCGGACCTGGCTCCTGGCCGACAAGACG
CCTGGAACCTGGGCCGCCGACTTCGGTTACGTCTTTCAACCCACCAAGCTCAGGCTGTGGAACACGCGCCACGAT
GGGCGCGGAACCAAGACGTTCCGCTTTCTTGCCTTTCCTATCAACGGAATCATGAATCTGACCTACGTCGATCCT
GCCACCGGGCGAAATGCGACGTGCACGAGCGAATGCCCCTTGAGCCACGATGCCGACCTTGCGTTTCAAGACTTT
CACTTCGTCAACCGAGTGGGCATGAACAGTTTTCAAATCGCCATTTCTGACTGGTACGGCGACGGCGCAGGTTTG
GCCGGCATCCAGCTGTTCCACGACGACATCTACGCCTACGCCATCCACGACTTCAACGAACCAACATGCGGAGGC
AATAAGTTTCCGTCCAAGGCTTCCGCCACCGGGCCGTGGGAACATTCCCCGTCGGTGCAAAGCAGCTCGGATTAC
TTGACGGCAAACCTGACGTCTTCCTCGCCACGTCAGTTGCCTTCCATCATCTTCTACCCCAGCATTCGCGAGTCT
GGCAACTATTCCGTCAACATGTACACGCCTGGCTGCATGCCTGATAGGTCGTGCCTGACGCGCGGCCGCGTCAAC
GTGACGGGCACCATGTCTTCCAGGACCACCAACGCCGGCTTCTCCGCGACTCTTTTCCAGACCAACAACTATGAC
AAATACGACCAGATCTACTTTGGCTACGTGGAGAAGACGTCTGACAGCTTCCAGCCCAGTGTCACCATCACCCCG
CTTGCTGGCCAGGACATGCCACTGACGGTGGTGGCCCAGAGAGTTGGCTTTAACCTCGTCAACTCGACTGGCGGG
CTCAATGGACTCTTCGACTTCAATCCGGACAACAACACGGTCGACGTAACCAAATTCGAGCAGTCACCCATCAAC
AAACTCGGCTCCGGCTTCAAGCGCAGTTCCGGCGTATCGTCGCTCGCCGCCTCGGGTGACATCGTCTATGTCGGT
GGCGACTTCCGCTCAGACGGCCGCGCGAACGTGGTTGCCATCGGAGGGACAAACAACGATGTTCAATCCCTTGAT
GGGGGCCTCAACGGCCGGGTCCTCGACATGCACCTCGAAGACACCAAGCTCTACGTCGGAGGCGACTTCACCGAC
AAACAAACGGCAACTCAGGATGGCCTGAACCACGTTGCTGTCTTCGACACGCGAGCCAGCACGTGGAGCGCGCTT
GGTGCCGGTGTGGACGGACGAGTGCAACACGTGGTGCCTTTGGTCATCAACATGACGGCAGACGCGATGGAGACG
GCCATTGCTTTGTCCGGAACCTTTGCTGAGTGCAGGGGTTTCGGTGACAATCGACCGATTCCCGTCGACGGTTTC
GCCGTCTGGGTCCCGTCGAAGAACAACTGGTTGCAGAACGTCGACGGTTCTCGTCCCGCCTACAATGGCATCCTT
ACCGCCGCCGTCGTTGATCTGCCCAACAACGACAAGCTCTTTGCCGGCTCGATGGAATCGGCGCAGGTGGGTGCA
AACGGCGCCGCTAGGTTGGGCGAGAAGGGCCTTAGCAGCCTCGCGTCTATCCATCTAATGGCTGCACCACCGACG
CCTACGAGGAGCCGCAGGGATGAGCTCTCGAACGGGGCTCGCGGCGTGGTCGCAGGCACCTTCTACGACAACGGC
GACGCCAACGTAACGGTGCTGGCCGGGCACTTTACGGCCCGGACGACGGACGGTTCGACCATTGACAACCTGGTG
CTGATAGACGGGGGCAAGAGCGGCGCCGTCAGCGGGCTGGGACCCGGGGTAGCCGCAGGATCGGCCTTCACGACG
GTGGCGATGCGCGGCAGCGTGCTATATGCCGGCGGCCAGGTCAGCGGCACGGTAGCGGACCGTCCGATCGGCGGC
ATCGTCGCCTACGACGTCAAGGCTAAGTCTTTCAGCAATCAGCCGGCTCCCGTGGCCGGCGGCGAGGGCACCGTA
TCGGCTATCACCGTCCGGCCCAACTCGGCCGAGGTCTACGTTGCAGGCTCATTCGAGAAGGCGGGCGCGCTTGAC
TGCCCTGCCGTATGCCTCTATAACGCGGACTTGGATCAGTGGATGCAGCCGGGCAACGGTCTCTCGGGTGAGGTG
TCGTGCCTCATGTGGTCGAGCGACTCTACGCTCATCGCCGGCGGCGACATGCGCGCCAACGGAACCGACAAGCAG
TACTTGACGGCTTTCAGCGTCAAGAGGCAAGCGTGGACGAGCTTCCCGGGGGCCGAGGGCATCCCCGGCCCCGTG
CAGGTGATGACGCCGGCGTCGAGCGACGGCAACCAAGTGTGGATTGCCGGCAAGTCAGCCCAGGACGGGTCGGTC
TTTCTCATGAAGTTCGACGGCAGCACATGGAAGAAGGCACCGCAAGCGCTGCCAGCCAAGACGGTGTTGCGCAGT
CTTCAAGTCTTTACGCTGACGAAGAGCCACGGCAAGACGGACATGCTCGAAGACAAGCAAGGTCTGATGCTCACC
GGCTCCATGGACCTGCCCGGCGTCGGGCCGGTCTCGGCGGTGTTATACAACGGCACGGACTACCTGCCGTACAGC
CTCACGACGCACTCGGGTCCCGGGGCGGGCAGCGTGGGCAAGATCTTCACGCAAAAGGACGACTTCTTCACGTCA
GACAGGGGCCACATGCCGCTCGTTTTCGTGGTGCTGATCGGACTGGCGATTGCGCTGGGCCTCATCCTGCTGATG
GTTCTGGCGGGCATCGTACTGGACCGGCTACGGAAGAAGCGCGAGGGCTACACACGGGCGCCGACATCGATGAAC
GACCGGGGCAGCGGCATCCATCGGATACCGCCGAGCGAGCTGCTCGAGTCGCTGGGCAAGAGCCGGCCCGGCGCG
CCGCACGTGTGA
Gene >Ophio5|355
ATGCGGCTACCCTTTCGACGGTGTCGCGTCGTGCGGCCGCCCGACTTTCTGCTGGCCCTGGCAGCTTTCGTGCCC
TCGCTAACCAGCGCTCTCGACTTCAAACCGGCGCCCGCCGCCAACCTCGACCTCTCCAGCCTGGGTGAGGTGGTC
ATCGCCGGTGACTTCAGCGGCATCTCTCTTTACCAGTATCACGGCCAGACCTCCACCGATCTCAGCACAAATGGC
AGCCAGTCCCTCCTCGCCCGCCTGCCCAACGGCGTCCTCTCTCCCGTGGCCGCTACCGATGCCTCGATACAGTCC
ATGTGCGCCTTGCGGCGAAAGAACGGCGACCTCGACAGCGTTGTTCTCGGAGGAAACTTCACCAGCCTCGACGGC
ATCCAGTCCACTGCCGTCGCCCTCTTCAACCCTACCACGTCCGAGTTCAAGCCCGTCAGTGGCCTCGAGGGCCAA
GTTAGCGCCCTCTACTGCGATCAGGAGCGGGAGCTCGTCTACATCGGCGGACGCTTTCACGGTGCAAACTCCACC
AATGCCCTCGCCTGGTCGAGCGCCAAGGGCTTGATTGACTTGCCCTTTGCTGGTTTCAACGGCCCCGTCGACGCC
ATCACCAAATCCTCAAACGGTCACATCATTTTCGGAGGCAATTTCACTGGCTTGGGCAACGCAAGTACGCCCAGT
CGGCCCGACGAGCAGGTCATCAATCTGTCCATCGCCAACACCACCGCCACCAATTCCGCCTCCATAGCTGGATTC
TCCGACCCAAAGTCACTGGCCTGCTCTGATGGCTCTGACGGCCCGGGCCGGACCTGGCTCCTGGCCGACAAGACG
CCTGGAACCTGGGCCGCCGACTTCGGTTACGTCTTTCAACCCACCAAGCTCAGGCTGTGGAACACGCGCCACGAT
GGGCGCGGAACCAAGACGTTCCGCTTTCTTGCCTTTCCTATCAACGGAATCATGAATCTGACCTACGTCGATCCT
GCCACCGGGCGAAATGCGACGTGCACGAGCGAATGCCCCTTGAGCCACGATGCCGACCTTGCGTTTCAAGACTTT
CACTTCGTCAACCGAGTGGGCATGAACAGTTTTCAAATCGCCATTTCTGACTGGTACGGCGACGGCGCAGGTTTG
GCCGGCATCCAGCTGTTCCACGACGACATCTACGCCTACGCCATCCACGACTTCAACGAACCAACATGCGGAGGC
AATAAGTTTCCGTCCAAGGCTTCCGCCACCGGGCCGTGGGAACATTCCCCGTCGGTGCAAAGCAGCTCGGATTAC
TTGACGGCAAACCTGACGTCTTCCTCGCCACGTCAGTTGCCTTCCATCATCTTCTACCCCAGCATTCGCGAGTCT
GGCAACTATTCCGTCAACATGTACACGCCTGGCTGCATGCCTGATAGGTCGTGCCTGACGCGCGGCCGCGTCAAC
GTGACGGGCACCATGTCTTCCAGGACCACCAACGCCGGCTTCTCCGCGACTCTTTTCCAGACCAACAACTATGAC
AAATACGACCAGATCTACTTTGGCTACGTGGAGAAGACGTCTGACAGCTTCCAGCCCAGTGTCACCATCACCCCG
CTTGCTGGCCAGGACATGCCACTGACGGTGGTGGCCCAGAGAGTTGGCTTTAACCTCGTCAACTCGACTGGCGGG
CTCAATGGACTCTTCGACTTCAATCCGGACAACAACACGGTCGACGTAACCAAATTCGAGCAGTCACCCATCAAC
AAACTCGGCTCCGGCTTCAAGCGCAGTTCCGGCGTATCGTCGCTCGCCGCCTCGGGTGACATCGTCTATGTCGGT
GGCGACTTCCGCTCAGACGGCCGCGCGAACGTGGTTGCCATCGGAGGGACAAACAACGATGTTCAATCCCTTGAT
GGGGGCCTCAACGGCCGGGTCCTCGACATGCACCTCGAAGACACCAAGCTCTACGTCGGAGGCGACTTCACCGAC
AAACAAACGGCAACTCAGGATGGCCTGAACCACGTTGCTGTCTTCGACACGCGAGCCAGCACGTGGAGCGCGCTT
GGTGCCGGTGTGGACGGACGAGTGCAACACGTGGTGCCTTTGGTCATCAACATGACGGCAGACGCGATGGAGACG
GCCATTGCTTTGTCCGGAACCTTTGCTGAGTGCAGGGGTTTCGGTGACAATCGACCGATTCCCGTCGACGGTTTC
GCCGTCTGGGTCCCGTCGAAGAACAACTGGTTGCAGAACGTCGACGGTTCTCGTCCCGCCTACAATGGCATCCTT
ACCGCCGCCGTCGTTGATCTGCCCAACAACGACAAGCTCTTTGCCGGCTCGATGGAATCGGCGCAGGTGGGTGCA
AACGGCGCCGCTAGGTTGGGCGAGAAGGGCCTTAGCAGCCTCGCGTCTATCCATCTAATGGCTGCACCACCGACG
CCTACGAGGAGCCGCAGGGATGAGCTCTCGAACGGGGCTCGCGGCGTGGTCGCAGGCACCTTCTACGACAACGGC
GACGCCAACGTAACGGTGCTGGCCGGGCACTTTACGGCCCGGACGACGGACGGTTCGACCATTGACAACCTGGTG
CTGATAGACGGGGGCAAGAGCGGCGCCGTCAGCGGGCTGGGACCCGGGGTAGCCGCAGGATCGGCCTTCACGACG
GTGGCGATGCGCGGCAGCGTGCTATATGCCGGCGGCCAGGTCAGCGGCACGGTAGCGGACCGTCCGATCGGCGGC
ATCGTCGCCTACGACGTCAAGGCTAAGTCTTTCAGCAATCAGCCGGCTCCCGTGGCCGGCGGCGAGGGCACCGTA
TCGGCTATCACCGTCCGGCCCAACTCGGCCGAGGTCTACGTTGCAGGCTCATTCGAGAAGGCGGGCGCGCTTGAC
TGCCCTGCCGTATGCCTCTATAACGCGGACTTGGATCAGTGGATGCAGCCGGGCAACGGTCTCTCGGGTGAGGTG
TCGTGCCTCATGTGGTCGAGCGACTCTACGCTCATCGCCGGCGGCGACATGCGCGCCAACGGAACCGACAAGCAG
TACTTGACGGCTTTCAGCGTCAAGAGGCAAGCGTGGACGAGCTTCCCGGGGGCCGAGGGCATCCCCGGCCCCGTG
CAGGTGATGACGCCGGCGTCGAGCGACGGCAACCAAGTGTGGATTGCCGGCAAGTCAGCCCAGGACGGGTCGGTC
TTTCTCATGAAGTTCGACGGCAGCACATGGAAGAAGGCACCGCAAGCGCTGCCAGCCAAGACGGTGTTGCGCAGT
CTTCAAGTCTTTACGCTGACGAAGAGCCACGGCAAGACGGACATGCTCGAAGACAAGCAAGGTCTGATGCTCACC
GGCTCCATGGACCTGCCCGGCGTCGGGCCGGTCTCGGCGGTGTTATACAACGGCACGGACTACCTGCCGTACAGC
CTCACGACGCACTCGGGTCCCGGGGCGGGCAGCGTGGGCAAGATCTTCACGCAAAAGGACGACTTCTTCACGTCA
GACAGGGGCCACATGCCGCTCGTTTTCGTGGTGCTGATCGGACTGGCGATTGCGCTGGGCCTCATCCTGCTGATG
GTTCTGGCGGGCATCGTACTGGACCGGCTACGGAAGAAGCGCGAGGGCTACACACGGGCGCCGACATCGATGAAC
GACCGGGGCAGCGGCATCCATCGGATACCGCCGAGCGAGCTGCTCGAGTCGCTGGGCAAGAGCCGGCCCGGCGCG
CCGCACGTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail