Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3545
Gene name
Locationscaffold_28:63487..64046
Strand+
Gene length (bp)559
Transcript length (bp)483
Coding sequence length (bp)480
Protein length (aa) 160

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08592 Anthrone_oxy Anthrone oxygenase 1.1E-22 49 150

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|B8NI03|HYPC_ASPFN Noranthrone monooxygenase OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=hypC PE=1 SV=1 49 152 2.0E-07

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.5

Transmembrane Domains

Domain # Start End Length
1 10 32 22
2 52 74 22
3 84 106 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3545
MQFPAPPLIAVATGIVGSAWASGAIVTFSISAAAATKAVSDATTAAQVWCELYARGSNVMPKVAVTVALSYAYAA
YDVFGRGGRWVGFAAAACSILSIVPFTLTAMKKTNAELHQATVDTPDAARVSSLIDTWVSLNFARGLLPLIGTVL
GIQSFLENTL
Coding >Ophio5|3545
ATGCAGTTCCCAGCTCCGCCTCTCATCGCTGTTGCTACCGGCATCGTCGGCTCGGCCTGGGCCTCGGGTGCCATC
GTCACCTTCTCCATATCCGCTGCGGCCGCGACCAAAGCCGTCTCGGATGCGACTACCGCCGCCCAGGTCTGGTGC
GAGCTCTACGCCCGCGGCTCCAACGTCATGCCCAAAGTCGCCGTCACCGTCGCCCTATCGTATGCCTATGCTGCG
TACGATGTCTTTGGTCGAGGCGGCCGTTGGGTTGGCTTCGCCGCCGCCGCCTGTTCCATTCTGTCCATCGTCCCA
TTCACCCTGACAGCTATGAAGAAGACCAATGCCGAGTTGCACCAGGCCACCGTCGACACTCCCGACGCCGCCCGT
GTCTCCAGCCTTATCGACACTTGGGTCAGCCTAAACTTTGCACGTGGGCTTCTGCCTCTTATCGGAACCGTCCTG
GGCATTCAGTCCTTCCTTGAAAACACTCTA
Transcript >Ophio5|3545
ATGCAGTTCCCAGCTCCGCCTCTCATCGCTGTTGCTACCGGCATCGTCGGCTCGGCCTGGGCCTCGGGTGCCATC
GTCACCTTCTCCATATCCGCTGCGGCCGCGACCAAAGCCGTCTCGGATGCGACTACCGCCGCCCAGGTCTGGTGC
GAGCTCTACGCCCGCGGCTCCAACGTCATGCCCAAAGTCGCCGTCACCGTCGCCCTATCGTATGCCTATGCTGCG
TACGATGTCTTTGGTCGAGGCGGCCGTTGGGTTGGCTTCGCCGCCGCCGCCTGTTCCATTCTGTCCATCGTCCCA
TTCACCCTGACAGCTATGAAGAAGACCAATGCCGAGTTGCACCAGGCCACCGTCGACACTCCCGACGCCGCCCGT
GTCTCCAGCCTTATCGACACTTGGGTCAGCCTAAACTTTGCACGTGGGCTTCTGCCTCTTATCGGAACCGTCCTG
GGCATTCAGTCCTTCCTTGAAAACACTCTATAG
Gene >Ophio5|3545
ATGCAGTTCCCAGCTCCGCCTCTCATCGCTGTTGCTACCGGCATCGTCGGCTCGGCCTGGGCCTCGGGTATGTTT
CTCGGCCGCTTACACCGCAGGCTGTCGTCTCCGTGAGCCTGCTGACAGGCTTCCCCCTCGCCATGTAGGTGCCAT
CGTCACCTTCTCCATATCCGCTGCGGCCGCGACCAAAGCCGTCTCGGATGCGACTACCGCCGCCCAGGTCTGGTG
CGAGCTCTACGCCCGCGGCTCCAACGTCATGCCCAAAGTCGCCGTCACCGTCGCCCTATCGTATGCCTATGCTGC
GTACGATGTCTTTGGTCGAGGCGGCCGTTGGGTTGGCTTCGCCGCCGCCGCCTGTTCCATTCTGTCCATCGTCCC
ATTCACCCTGACAGCTATGAAGAAGACCAATGCCGAGTTGCACCAGGCCACCGTCGACACTCCCGACGCCGCCCG
TGTCTCCAGCCTTATCGACACTTGGGTCAGCCTAAACTTTGCACGTGGGCTTCTGCCTCTTATCGGAACCGTCCT
GGGCATTCAGTCCTTCCTTGAAAACACTCTATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail