Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3542
Gene name
Locationscaffold_28:59924..61215
Strand-
Gene length (bp)1291
Transcript length (bp)834
Coding sequence length (bp)831
Protein length (aa) 277

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.2929 0.2323 0.8623 0.1091 0.1013 0.0871 0.3558 0.2348 0.1704 0.0123

SignalP

SignalP signal predicted Location Score
Yes 1 - 53 0.565879

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup569
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2676
Ophiocordyceps australis 1348a (Ghana) OphauG2|6197
Ophiocordyceps australis map64 (Brazil) OphauB2|4006
Ophiocordyceps camponoti-floridani Ophcf2|03295
Ophiocordyceps camponoti-rufipedis Ophun1|7314
Ophiocordyceps kimflemingae Ophio5|3542 (this protein)
Ophiocordyceps subramaniannii Hirsu2|5316
Ophiocordyceps subramaniannii Hirsu2|8001

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3542
MFHSPTSHRPIGDFVLQVDGPQLPQWTRTNGFERMHVAVLLLLTLILVSGTEGLSLPCIINASKDQVVLPVAAYR
LNPNMHLPRLAQFVTALVWLTVTQAGRPRPGAHIETCHDGEGSNLHCYNGKDDIPQNVDIKDIAEAGQALRNYGR
EEKGGRFLTMTAANAADCAEWTIFELRTVLVLAKHIGSEKDSSVLFEDIARTIADEPVISDESDQKPIISCLTAG
GSLGVRVNETNPAYKSDDYKKSGYTPDGIIIKIVSNVRKKTAPVWICGSEMR
Coding >Ophio5|3542
ATGTTTCACTCACCAACTTCCCATAGGCCTATTGGCGATTTCGTCCTGCAAGTAGACGGCCCGCAATTGCCGCAG
TGGACGAGAACGAACGGCTTCGAACGCATGCACGTGGCTGTGCTTCTCCTCCTCACCCTCATTCTTGTTTCGGGG
ACGGAAGGATTGTCATTGCCTTGCATAATAAACGCCTCCAAAGATCAAGTCGTGCTCCCAGTCGCCGCCTACCGT
CTAAACCCCAATATGCACCTTCCACGACTGGCCCAATTCGTGACGGCCCTTGTCTGGCTTACGGTAACTCAGGCT
GGTCGTCCGAGACCCGGGGCTCACATCGAGACCTGCCACGACGGCGAGGGCTCAAACCTCCACTGCTACAACGGC
AAAGACGACATCCCGCAGAATGTAGACATCAAAGACATCGCCGAGGCCGGTCAGGCCCTGCGCAATTACGGCCGC
GAAGAAAAGGGCGGCCGCTTCTTGACCATGACGGCCGCCAACGCCGCCGACTGCGCCGAATGGACCATCTTCGAG
CTTCGGACCGTCCTGGTTCTGGCCAAGCACATCGGCTCCGAGAAAGATTCGTCAGTACTGTTTGAAGATATCGCC
AGGACTATTGCCGATGAGCCTGTCATTTCCGACGAAAGCGACCAGAAGCCCATCATCAGCTGCTTGACCGCCGGT
GGTTCCCTCGGCGTCCGAGTCAACGAGACAAATCCAGCGTACAAGTCGGACGACTACAAAAAGTCGGGCTACACG
CCAGATGGCATCATCATCAAGATTGTCTCCAACGTCCGCAAGAAGACCGCACCGGTTTGGATTTGTGGTTCGGAA
ATGAGA
Transcript >Ophio5|3542
ATGTTTCACTCACCAACTTCCCATAGGCCTATTGGCGATTTCGTCCTGCAAGTAGACGGCCCGCAATTGCCGCAG
TGGACGAGAACGAACGGCTTCGAACGCATGCACGTGGCTGTGCTTCTCCTCCTCACCCTCATTCTTGTTTCGGGG
ACGGAAGGATTGTCATTGCCTTGCATAATAAACGCCTCCAAAGATCAAGTCGTGCTCCCAGTCGCCGCCTACCGT
CTAAACCCCAATATGCACCTTCCACGACTGGCCCAATTCGTGACGGCCCTTGTCTGGCTTACGGTAACTCAGGCT
GGTCGTCCGAGACCCGGGGCTCACATCGAGACCTGCCACGACGGCGAGGGCTCAAACCTCCACTGCTACAACGGC
AAAGACGACATCCCGCAGAATGTAGACATCAAAGACATCGCCGAGGCCGGTCAGGCCCTGCGCAATTACGGCCGC
GAAGAAAAGGGCGGCCGCTTCTTGACCATGACGGCCGCCAACGCCGCCGACTGCGCCGAATGGACCATCTTCGAG
CTTCGGACCGTCCTGGTTCTGGCCAAGCACATCGGCTCCGAGAAAGATTCGTCAGTACTGTTTGAAGATATCGCC
AGGACTATTGCCGATGAGCCTGTCATTTCCGACGAAAGCGACCAGAAGCCCATCATCAGCTGCTTGACCGCCGGT
GGTTCCCTCGGCGTCCGAGTCAACGAGACAAATCCAGCGTACAAGTCGGACGACTACAAAAAGTCGGGCTACACG
CCAGATGGCATCATCATCAAGATTGTCTCCAACGTCCGCAAGAAGACCGCACCGGTTTGGATTTGTGGTTCGGAA
ATGAGATAG
Gene >Ophio5|3542
ATGTTTCACTCACCAACTTCCCATAGGCCTATTGGCGATTTCGTCCTGCAAGTACGAATACGGATACGCGATGCA
GACCGGGTGGCCATCATCTCTTCTCGCGATGCCGCTTTTATGTGTCACGTACAGGCTCATGCTTGAGTGGCGACT
CTGTACAGGTAGACGGCCCGCAATTGCCGCAGTGGACGAGAACGAACGGCTTCGAACGCATGCACGTGGCTGTGC
TTCTCCTCCTCACCCTCATTCGTCGACTTCCGTAACGCGAAGTTGCTGTGAGACAAGACGTCTCAGCCGCAACAT
CAGGACGCAAAGACGCCGGCAGGTGAAGAAGAGCATAAATACGAGGACTAGTTGTTTCGGGGACGGAAGGATTGT
CATTGCCTTGTGTGCACGCACTCCTGCTCCTCTTTCTACTTTACACGAGGCCGATAACAGACCGCAGCTCACATA
CCACTCCTAGGCATAATAAACGCCTCCAAAGATCAAGTCGTGCTCCCAGTCGCCGCCTACCGTCTAAACCCCAAT
ATGCACCTTCCACGACTGGCCCAATTCGTGACGGCCCTTGTCTGGCTTACGGTAACTCAGGCTGGTCGTCCGAGA
CCCGGGGCTCACATCGAGACCTGCCACGACGGCGAGGGCTCAAACCTCCACTGCTACAACGGCAAAGACGACATC
CCGCAGAATGTAGACATCAAAGACATCGCCGAGGCCGGTCAGGCCCTGCGCAATTACGGCCGCGAAGAAAAGGGC
GGCCGCTTCTTGACCATGACGGCCGCCAACGCCGCCGACTGCGCCGAATGGACCATCTTCGAGCTTCGGACCGTC
CTGGTTCTGGCCAAGCACATCGGCTCCGAGAAAGATTCGTCAGTACTGTTTGAAGATATCGCCAGGACTATTGCC
GATGAGCCTGTCATTTCCGACGAAAGCGACCAGAAGCCCATCATCAGCTGCTTGACCGCCGGTGGTTCCCTCGGC
GTCCGAGTCAACGAGACAAATCCAGCGTACAAGTCGGACGACTACAAAAAGTCGGGCTACACGCCAGATGGCATC
ATCATCAAGATTGTCTCCAACGTCCGCAAGGTCGACCTTTGAGCGCTCCGCTTGCTGGGGCTCTGAGGCATGTTC
TTCTCCGTCCGTTATTGAGGGCGGTTGAAAGAAGACCGCACCGGTTTGGATTTGTGGTGAGTGAACTGGCTGGCT
GTCGGAGCTCCTCACTGAGGGACACTCATCCTGATTTCTGCGGTGATCATCGTCTACGCTCGCTTTCATGTCAGG
TTCGGAAATGAGATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail