Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3541
Gene name
Locationscaffold_28:58546..59836
Strand+
Gene length (bp)1290
Transcript length (bp)621
Coding sequence length (bp)618
Protein length (aa) 206

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01775 Ribosomal_L18A Ribosomal proteins 50S-L18Ae/60S-L20/60S-L18A 3.2E-53 4 126

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P0CX23|RL20A_YEAST 60S ribosomal protein L20-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL20A PE=1 SV=1 1 139 3.0E-68
sp|P0CX24|RL20B_YEAST 60S ribosomal protein L20-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL20B PE=1 SV=1 1 139 3.0E-68
sp|P0CT69|RL20B_SCHPO 60S ribosomal protein L20-B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl2002 PE=1 SV=1 4 139 1.0E-63
sp|P0CT68|RL20A_SCHPO 60S ribosomal protein L20-A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl2001 PE=1 SV=1 4 139 1.0E-63
sp|Q8WQI7|RL18A_SPOFR 60S ribosomal protein L18a OS=Spodoptera frugiperda GN=RpL18A PE=2 SV=1 2 138 2.0E-55
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P0CX23|RL20A_YEAST 60S ribosomal protein L20-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL20A PE=1 SV=1 1 139 3.0E-68
sp|P0CX24|RL20B_YEAST 60S ribosomal protein L20-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL20B PE=1 SV=1 1 139 3.0E-68
sp|P0CT69|RL20B_SCHPO 60S ribosomal protein L20-B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl2002 PE=1 SV=1 4 139 1.0E-63
sp|P0CT68|RL20A_SCHPO 60S ribosomal protein L20-A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl2001 PE=1 SV=1 4 139 1.0E-63
sp|Q8WQI7|RL18A_SPOFR 60S ribosomal protein L18a OS=Spodoptera frugiperda GN=RpL18A PE=2 SV=1 2 138 2.0E-55
sp|O57561|RL18A_SALSA 60S ribosomal protein L18a OS=Salmo salar GN=rpl18a PE=2 SV=1 2 138 1.0E-53
sp|P41093|RL18A_DROME 60S ribosomal protein L18a OS=Drosophila melanogaster GN=RpL18A PE=1 SV=1 2 143 6.0E-53
sp|Q90YU9|RL18A_ICTPU 60S ribosomal protein L18a OS=Ictalurus punctatus GN=rpl18a PE=2 SV=1 2 126 1.0E-52
sp|Q7ZWJ4|RL18A_DANRE 60S ribosomal protein L18a OS=Danio rerio GN=rpl18a PE=2 SV=1 2 138 3.0E-52
sp|Q3T003|RL18A_BOVIN 60S ribosomal protein L18a OS=Bos taurus GN=RPL18A PE=2 SV=1 2 138 3.0E-51
sp|Q02543|RL18A_HUMAN 60S ribosomal protein L18a OS=Homo sapiens GN=RPL18A PE=1 SV=2 2 138 3.0E-51
sp|P62718|RL18A_RAT 60S ribosomal protein L18a OS=Rattus norvegicus GN=Rpl18a PE=2 SV=1 2 129 6.0E-51
sp|P62717|RL18A_MOUSE 60S ribosomal protein L18a OS=Mus musculus GN=Rpl18a PE=1 SV=1 2 129 6.0E-51
sp|O44480|RL18A_CAEEL 60S ribosomal protein L18a OS=Caenorhabditis elegans GN=rpl-20 PE=3 SV=2 4 137 1.0E-47
sp|Q54MK8|RL18A_DICDI 60S ribosomal protein L18a OS=Dictyostelium discoideum GN=rpl18a PE=3 SV=2 4 129 1.0E-46
sp|P51418|R18A2_ARATH 60S ribosomal protein L18a-2 OS=Arabidopsis thaliana GN=RPL18AB PE=2 SV=2 3 129 5.0E-46
sp|Q8L7K0|R18A1_ARATH 60S ribosomal protein L18a-1 OS=Arabidopsis thaliana GN=RPL18AA PE=2 SV=1 3 129 3.0E-45
sp|Q9ATF5|RL18A_CASSA 60S ribosomal protein L18a OS=Castanea sativa GN=RPL18A PE=2 SV=1 3 129 4.0E-45
sp|Q943F3|RL18A_ORYSJ 60S ribosomal protein L18a OS=Oryza sativa subsp. japonica GN=RPL18A PE=1 SV=1 3 129 2.0E-44
sp|Q9LUD4|R18A3_ARATH 60S ribosomal protein L18a-3 OS=Arabidopsis thaliana GN=RPL18AC PE=2 SV=1 3 129 9.0E-44
sp|P0DJ18|RL18A_TETTH 60S ribosomal protein L18a OS=Tetrahymena thermophila GN=RPL18A PE=1 SV=1 3 138 3.0E-32
[Show less]

GO

GO Term Description Terminal node
GO:0005840 ribosome Yes
GO:0003735 structural constituent of ribosome Yes
GO:0006412 translation Yes
GO:0006518 peptide metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0003674 molecular_function No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0043226 organelle No
GO:1901576 organic substance biosynthetic process No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0044238 primary metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0043228 non-membrane-bounded organelle No
GO:1901564 organonitrogen compound metabolic process No
GO:0008150 biological_process No
GO:0043170 macromolecule metabolic process No
GO:0071704 organic substance metabolic process No
GO:0009058 biosynthetic process No
GO:0110165 cellular anatomical entity No
GO:0009987 cellular process No
GO:0043603 cellular amide metabolic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0019538 protein metabolic process No
GO:0043229 intracellular organelle No
GO:0009059 macromolecule biosynthetic process No
GO:0005575 cellular_component No
GO:0005198 structural molecule activity No
GO:0043043 peptide biosynthetic process No
GO:0006807 nitrogen compound metabolic process No
GO:0043604 amide biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0044249 cellular biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 57 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3541
MGRLQEYEVIGRHLPTESNPTPDMYRMTIFAPNQTVAKSRFWYFLRGLRKVKKATGEIVSIKTLHEKHPQKVKNF
GIWLRYDSRSGTHNMYKEYREMSRVDAVEALYADMAARHRARFRSIHILRVVELEKTEDIKRPFPAFEGGWARLR
MVPKQTKQKFPLALGHGGQIVRCDKLVASSGRSLGKRHDTGNGKASFTARLGPVDT
Coding >Ophio5|3541
ATGGGTCGTCTTCAGGAGTACGAGGTCATCGGGCGCCATCTGCCCACCGAGTCCAACCCGACGCCGGACATGTAC
CGGATGACCATCTTTGCGCCCAACCAGACCGTGGCCAAGTCCAGATTCTGGTACTTCTTGCGAGGCCTGCGCAAG
GTCAAGAAGGCCACCGGCGAGATCGTCAGCATCAAGACGCTGCACGAGAAGCACCCCCAGAAGGTCAAGAACTTT
GGCATCTGGCTTCGCTACGACTCGCGCTCTGGCACGCACAACATGTACAAGGAGTATCGTGAGATGTCGCGTGTC
GATGCTGTCGAGGCACTGTATGCCGACATGGCTGCCCGCCACCGCGCCCGCTTCAGGTCGATTCACATCCTCCGC
GTTGTCGAGCTCGAGAAGACCGAGGATATCAAGCGACCATTTCCTGCTTTCGAGGGCGGTTGGGCAAGGCTGCGA
ATGGTGCCAAAACAAACCAAACAAAAATTTCCTCTAGCCTTGGGCCATGGTGGACAGATAGTACGTTGTGATAAG
CTCGTGGCGAGCTCTGGGCGGTCTCTAGGCAAGAGACATGATACTGGTAACGGCAAGGCCTCTTTCACGGCGAGG
CTTGGCCCCGTGGATACC
Transcript >Ophio5|3541
ATGGGTCGTCTTCAGGAGTACGAGGTCATCGGGCGCCATCTGCCCACCGAGTCCAACCCGACGCCGGACATGTAC
CGGATGACCATCTTTGCGCCCAACCAGACCGTGGCCAAGTCCAGATTCTGGTACTTCTTGCGAGGCCTGCGCAAG
GTCAAGAAGGCCACCGGCGAGATCGTCAGCATCAAGACGCTGCACGAGAAGCACCCCCAGAAGGTCAAGAACTTT
GGCATCTGGCTTCGCTACGACTCGCGCTCTGGCACGCACAACATGTACAAGGAGTATCGTGAGATGTCGCGTGTC
GATGCTGTCGAGGCACTGTATGCCGACATGGCTGCCCGCCACCGCGCCCGCTTCAGGTCGATTCACATCCTCCGC
GTTGTCGAGCTCGAGAAGACCGAGGATATCAAGCGACCATTTCCTGCTTTCGAGGGCGGTTGGGCAAGGCTGCGA
ATGGTGCCAAAACAAACCAAACAAAAATTTCCTCTAGCCTTGGGCCATGGTGGACAGATAGTACGTTGTGATAAG
CTCGTGGCGAGCTCTGGGCGGTCTCTAGGCAAGAGACATGATACTGGTAACGGCAAGGCCTCTTTCACGGCGAGG
CTTGGCCCCGTGGATACCTAG
Gene >Ophio5|3541
ATGGGTAAGTTTGTTTTCCATTTCCTGTCCGGCTGTCATTCCGCGCTGCGCTGCGCCCCGGTATCGAGGTTAGAG
AACGATGCCACGGCGCTCGACGGCATAGCATACCTCCAACCCATAGATGTCGATCACAGAAAACGGCGAAATCCT
TTACAACGAGCTGCGCCATGTTTAATCGGCAAGCATTCGCGGCTACTTCGTGGCTTCCAGGTCGTCCAGGCATGG
GAGGAGGCTTCTCAGCACTGGGCGCGGACATGCACCATCCCATCGCCTTGGGCTTCGACAACGAGACAACAGACG
CGACTGATTACTGCCCTCTCCGCTCTCGAAATACTCATACCGGGCACCATTTCGTCGAGGACATACAAAACTGAT
GACTCTTTTCAACAGGTCGTCTTCAGGAGTACGAGGTCATCGGGCGCCATCTGCCCACCGAGTCCAACCCGACGC
CGGACATGTACCGGATGACCATCTTTGCGCCCAACCAGACCGTGGCCAAGTCCAGATTCTGGTACTTCTTGCGAG
GCCTGCGCAAGGTCAAGAAGGCCACCGGCGAGATCGTCAGCATCAAGACGGTATGGCGTCATTCGTCAATGACTT
AAGCGGCAAGATGGGGGCTCACATAGGATTTAGCTGCACGAGAAGCACCCCCAGAAGGTCAAGAACTTTGGCATC
TGGCTTCGCTACGACTCGCGCTCTGGCACGCACAACATGTACAAGGAGTATCGTGAGATGTCGCGTGTCGATGCT
GTCGAGGCACTGTATGCCGACATGGCTGCCCGCCACCGCGCCCGCTTCAGGTCGATTCACGTATGTGCAGCTGGT
TGCCTTCTTCTATTGGCGGCTACTCGCTGACCAGTCACAGATCCTCCGCGTTGTCGAGCTCGAGAAGACCGAGGA
TATCAAGCGACCGTACATCAAGCAGCTCGTCACCAAGAACCTCCGATTCCCTCTTCCCCACCGCATCAGCAAGGG
CTCCAACCAGAAGCTGTTCAGCGCAACGCGTCCGTCTACCTTTGCTTAGATTTCCTGCTTTCGAGGGCGGTTGGG
CAAGGTCTGCGGGTGTTCCCTACGGTTCATGGAAATATCAAGTTCAATGCCTGACGTCGCAGGCTGCGAATGGTG
CCAAAACAAACCAAACAAAAATTTCCTCTAGCCTTGGGCCATGGTGGACAGATAGTACGTTGTGATAAGCTCGTG
GCGAGCTCTGGGCGGTCTCTAGGCAAGAGACATGATACTGGTAACGGCAAGGCCTCTTTCACGGCGAGGCTTGGC
CCCGTGGATACCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail