Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3541
Gene name
Locationscaffold_28:58546..59836
Strand+
Gene length (bp)1290
Transcript length (bp)621
Coding sequence length (bp)618
Protein length (aa) 206

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01775 Ribosomal_L18A Ribosomal proteins 50S-L18Ae/60S-L20/60S-L18A 3.2E-53 4 126

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P0CX23|RL20A_YEAST 60S ribosomal protein L20-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL20A PE=1 SV=1 1 139 3.0E-68
sp|P0CX24|RL20B_YEAST 60S ribosomal protein L20-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL20B PE=1 SV=1 1 139 3.0E-68
sp|P0CT69|RL20B_SCHPO 60S ribosomal protein L20-B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl2002 PE=1 SV=1 4 139 1.0E-63
sp|P0CT68|RL20A_SCHPO 60S ribosomal protein L20-A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl2001 PE=1 SV=1 4 139 1.0E-63
sp|Q8WQI7|RL18A_SPOFR 60S ribosomal protein L18a OS=Spodoptera frugiperda GN=RpL18A PE=2 SV=1 2 138 2.0E-55
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P0CX23|RL20A_YEAST 60S ribosomal protein L20-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL20A PE=1 SV=1 1 139 3.0E-68
sp|P0CX24|RL20B_YEAST 60S ribosomal protein L20-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL20B PE=1 SV=1 1 139 3.0E-68
sp|P0CT69|RL20B_SCHPO 60S ribosomal protein L20-B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl2002 PE=1 SV=1 4 139 1.0E-63
sp|P0CT68|RL20A_SCHPO 60S ribosomal protein L20-A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl2001 PE=1 SV=1 4 139 1.0E-63
sp|Q8WQI7|RL18A_SPOFR 60S ribosomal protein L18a OS=Spodoptera frugiperda GN=RpL18A PE=2 SV=1 2 138 2.0E-55
sp|O57561|RL18A_SALSA 60S ribosomal protein L18a OS=Salmo salar GN=rpl18a PE=2 SV=1 2 138 1.0E-53
sp|P41093|RL18A_DROME 60S ribosomal protein L18a OS=Drosophila melanogaster GN=RpL18A PE=1 SV=1 2 143 6.0E-53
sp|Q90YU9|RL18A_ICTPU 60S ribosomal protein L18a OS=Ictalurus punctatus GN=rpl18a PE=2 SV=1 2 126 1.0E-52
sp|Q7ZWJ4|RL18A_DANRE 60S ribosomal protein L18a OS=Danio rerio GN=rpl18a PE=2 SV=1 2 138 3.0E-52
sp|Q3T003|RL18A_BOVIN 60S ribosomal protein L18a OS=Bos taurus GN=RPL18A PE=2 SV=1 2 138 3.0E-51
sp|Q02543|RL18A_HUMAN 60S ribosomal protein L18a OS=Homo sapiens GN=RPL18A PE=1 SV=2 2 138 3.0E-51
sp|P62718|RL18A_RAT 60S ribosomal protein L18a OS=Rattus norvegicus GN=Rpl18a PE=2 SV=1 2 129 6.0E-51
sp|P62717|RL18A_MOUSE 60S ribosomal protein L18a OS=Mus musculus GN=Rpl18a PE=1 SV=1 2 129 6.0E-51
sp|O44480|RL18A_CAEEL 60S ribosomal protein L18a OS=Caenorhabditis elegans GN=rpl-20 PE=3 SV=2 4 137 1.0E-47
sp|Q54MK8|RL18A_DICDI 60S ribosomal protein L18a OS=Dictyostelium discoideum GN=rpl18a PE=3 SV=2 4 129 1.0E-46
sp|P51418|R18A2_ARATH 60S ribosomal protein L18a-2 OS=Arabidopsis thaliana GN=RPL18AB PE=2 SV=2 3 129 5.0E-46
sp|Q8L7K0|R18A1_ARATH 60S ribosomal protein L18a-1 OS=Arabidopsis thaliana GN=RPL18AA PE=2 SV=1 3 129 3.0E-45
sp|Q9ATF5|RL18A_CASSA 60S ribosomal protein L18a OS=Castanea sativa GN=RPL18A PE=2 SV=1 3 129 4.0E-45
sp|Q943F3|RL18A_ORYSJ 60S ribosomal protein L18a OS=Oryza sativa subsp. japonica GN=RPL18A PE=1 SV=1 3 129 2.0E-44
sp|Q9LUD4|R18A3_ARATH 60S ribosomal protein L18a-3 OS=Arabidopsis thaliana GN=RPL18AC PE=2 SV=1 3 129 9.0E-44
sp|P0DJ18|RL18A_TETTH 60S ribosomal protein L18a OS=Tetrahymena thermophila GN=RPL18A PE=1 SV=1 3 138 3.0E-32
[Show less]

GO

GO Term Description Terminal node
GO:0005840 ribosome Yes
GO:0003735 structural constituent of ribosome Yes
GO:0006412 translation Yes
GO:0006518 peptide metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0003674 molecular_function No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0043226 organelle No
GO:1901576 organic substance biosynthetic process No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0044238 primary metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0043228 non-membrane-bounded organelle No
GO:1901564 organonitrogen compound metabolic process No
GO:0008150 biological_process No
GO:0043170 macromolecule metabolic process No
GO:0071704 organic substance metabolic process No
GO:0009058 biosynthetic process No
GO:0110165 cellular anatomical entity No
GO:0009987 cellular process No
GO:0043603 cellular amide metabolic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0019538 protein metabolic process No
GO:0043229 intracellular organelle No
GO:0009059 macromolecule biosynthetic process No
GO:0005575 cellular_component No
GO:0005198 structural molecule activity No
GO:0043043 peptide biosynthetic process No
GO:0006807 nitrogen compound metabolic process No
GO:0043604 amide biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0044249 cellular biosynthetic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear localization signal 0.5717 0.5079 0.027 0.1538 0.1723 0.0116 0.1015 0.0956 0.0456 0.0108

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2024
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4666
Ophiocordyceps australis map64 (Brazil) OphauB2|4510
Ophiocordyceps camponoti-floridani Ophcf2|03296
Ophiocordyceps camponoti-rufipedis Ophun1|7315
Ophiocordyceps kimflemingae Ophio5|3541 (this protein)
Ophiocordyceps subramaniannii Hirsu2|2288

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3541
MGRLQEYEVIGRHLPTESNPTPDMYRMTIFAPNQTVAKSRFWYFLRGLRKVKKATGEIVSIKTLHEKHPQKVKNF
GIWLRYDSRSGTHNMYKEYREMSRVDAVEALYADMAARHRARFRSIHILRVVELEKTEDIKRPFPAFEGGWARLR
MVPKQTKQKFPLALGHGGQIVRCDKLVASSGRSLGKRHDTGNGKASFTARLGPVDT
Coding >Ophio5|3541
ATGGGTCGTCTTCAGGAGTACGAGGTCATCGGGCGCCATCTGCCCACCGAGTCCAACCCGACGCCGGACATGTAC
CGGATGACCATCTTTGCGCCCAACCAGACCGTGGCCAAGTCCAGATTCTGGTACTTCTTGCGAGGCCTGCGCAAG
GTCAAGAAGGCCACCGGCGAGATCGTCAGCATCAAGACGCTGCACGAGAAGCACCCCCAGAAGGTCAAGAACTTT
GGCATCTGGCTTCGCTACGACTCGCGCTCTGGCACGCACAACATGTACAAGGAGTATCGTGAGATGTCGCGTGTC
GATGCTGTCGAGGCACTGTATGCCGACATGGCTGCCCGCCACCGCGCCCGCTTCAGGTCGATTCACATCCTCCGC
GTTGTCGAGCTCGAGAAGACCGAGGATATCAAGCGACCATTTCCTGCTTTCGAGGGCGGTTGGGCAAGGCTGCGA
ATGGTGCCAAAACAAACCAAACAAAAATTTCCTCTAGCCTTGGGCCATGGTGGACAGATAGTACGTTGTGATAAG
CTCGTGGCGAGCTCTGGGCGGTCTCTAGGCAAGAGACATGATACTGGTAACGGCAAGGCCTCTTTCACGGCGAGG
CTTGGCCCCGTGGATACC
Transcript >Ophio5|3541
ATGGGTCGTCTTCAGGAGTACGAGGTCATCGGGCGCCATCTGCCCACCGAGTCCAACCCGACGCCGGACATGTAC
CGGATGACCATCTTTGCGCCCAACCAGACCGTGGCCAAGTCCAGATTCTGGTACTTCTTGCGAGGCCTGCGCAAG
GTCAAGAAGGCCACCGGCGAGATCGTCAGCATCAAGACGCTGCACGAGAAGCACCCCCAGAAGGTCAAGAACTTT
GGCATCTGGCTTCGCTACGACTCGCGCTCTGGCACGCACAACATGTACAAGGAGTATCGTGAGATGTCGCGTGTC
GATGCTGTCGAGGCACTGTATGCCGACATGGCTGCCCGCCACCGCGCCCGCTTCAGGTCGATTCACATCCTCCGC
GTTGTCGAGCTCGAGAAGACCGAGGATATCAAGCGACCATTTCCTGCTTTCGAGGGCGGTTGGGCAAGGCTGCGA
ATGGTGCCAAAACAAACCAAACAAAAATTTCCTCTAGCCTTGGGCCATGGTGGACAGATAGTACGTTGTGATAAG
CTCGTGGCGAGCTCTGGGCGGTCTCTAGGCAAGAGACATGATACTGGTAACGGCAAGGCCTCTTTCACGGCGAGG
CTTGGCCCCGTGGATACCTAG
Gene >Ophio5|3541
ATGGGTAAGTTTGTTTTCCATTTCCTGTCCGGCTGTCATTCCGCGCTGCGCTGCGCCCCGGTATCGAGGTTAGAG
AACGATGCCACGGCGCTCGACGGCATAGCATACCTCCAACCCATAGATGTCGATCACAGAAAACGGCGAAATCCT
TTACAACGAGCTGCGCCATGTTTAATCGGCAAGCATTCGCGGCTACTTCGTGGCTTCCAGGTCGTCCAGGCATGG
GAGGAGGCTTCTCAGCACTGGGCGCGGACATGCACCATCCCATCGCCTTGGGCTTCGACAACGAGACAACAGACG
CGACTGATTACTGCCCTCTCCGCTCTCGAAATACTCATACCGGGCACCATTTCGTCGAGGACATACAAAACTGAT
GACTCTTTTCAACAGGTCGTCTTCAGGAGTACGAGGTCATCGGGCGCCATCTGCCCACCGAGTCCAACCCGACGC
CGGACATGTACCGGATGACCATCTTTGCGCCCAACCAGACCGTGGCCAAGTCCAGATTCTGGTACTTCTTGCGAG
GCCTGCGCAAGGTCAAGAAGGCCACCGGCGAGATCGTCAGCATCAAGACGGTATGGCGTCATTCGTCAATGACTT
AAGCGGCAAGATGGGGGCTCACATAGGATTTAGCTGCACGAGAAGCACCCCCAGAAGGTCAAGAACTTTGGCATC
TGGCTTCGCTACGACTCGCGCTCTGGCACGCACAACATGTACAAGGAGTATCGTGAGATGTCGCGTGTCGATGCT
GTCGAGGCACTGTATGCCGACATGGCTGCCCGCCACCGCGCCCGCTTCAGGTCGATTCACGTATGTGCAGCTGGT
TGCCTTCTTCTATTGGCGGCTACTCGCTGACCAGTCACAGATCCTCCGCGTTGTCGAGCTCGAGAAGACCGAGGA
TATCAAGCGACCGTACATCAAGCAGCTCGTCACCAAGAACCTCCGATTCCCTCTTCCCCACCGCATCAGCAAGGG
CTCCAACCAGAAGCTGTTCAGCGCAACGCGTCCGTCTACCTTTGCTTAGATTTCCTGCTTTCGAGGGCGGTTGGG
CAAGGTCTGCGGGTGTTCCCTACGGTTCATGGAAATATCAAGTTCAATGCCTGACGTCGCAGGCTGCGAATGGTG
CCAAAACAAACCAAACAAAAATTTCCTCTAGCCTTGGGCCATGGTGGACAGATAGTACGTTGTGATAAGCTCGTG
GCGAGCTCTGGGCGGTCTCTAGGCAAGAGACATGATACTGGTAACGGCAAGGCCTCTTTCACGGCGAGGCTTGGC
CCCGTGGATACCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail