Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3540
Gene name
Locationscaffold_28:56195..57847
Strand-
Gene length (bp)1652
Transcript length (bp)1371
Coding sequence length (bp)1368
Protein length (aa) 456

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01399 PCI PCI domain 2.7E-11 324 447

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7SD63|CSN12_NEUCR Protein CSN12 homolog OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=csn-8 PE=3 SV=2 1 456 0.0E+00
sp|Q4IMN9|CSN12_GIBZE Protein CSN12 homolog OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=CSN12 PE=3 SV=2 1 456 0.0E+00
sp|Q4WJX0|CSN12_ASPFU Protein CSN12 homolog OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=csn12 PE=3 SV=1 1 456 2.0E-161
sp|O13873|CSN12_SCHPO Protein CSN12 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=csn12 PE=3 SV=1 102 452 4.0E-67
sp|Q4P8T5|CSN12_USTMA Protein CSN12 homolog OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CSN12 PE=3 SV=1 102 453 3.0E-61
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7SD63|CSN12_NEUCR Protein CSN12 homolog OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=csn-8 PE=3 SV=2 1 456 0.0E+00
sp|Q4IMN9|CSN12_GIBZE Protein CSN12 homolog OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=CSN12 PE=3 SV=2 1 456 0.0E+00
sp|Q4WJX0|CSN12_ASPFU Protein CSN12 homolog OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=csn12 PE=3 SV=1 1 456 2.0E-161
sp|O13873|CSN12_SCHPO Protein CSN12 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=csn12 PE=3 SV=1 102 452 4.0E-67
sp|Q4P8T5|CSN12_USTMA Protein CSN12 homolog OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CSN12 PE=3 SV=1 102 453 3.0E-61
sp|Q6C1L4|CSN12_YARLI Protein CSN12 homolog OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CSN12 PE=3 SV=1 122 452 2.0E-51
sp|P0CR48|CSN12_CRYNJ Protein CSN12 homolog OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CSN12 PE=3 SV=1 98 452 2.0E-48
sp|P0CR49|CSN12_CRYNB Protein CSN12 homolog OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CSN12 PE=3 SV=1 98 452 2.0E-48
sp|Q5JVF3|PCID2_HUMAN PCI domain-containing protein 2 OS=Homo sapiens GN=PCID2 PE=1 SV=2 94 452 2.0E-47
sp|Q5FWP8|PCID2_XENLA PCI domain-containing protein 2 OS=Xenopus laevis GN=pcid2 PE=2 SV=1 112 452 1.0E-45
sp|Q8BFV2|PCID2_MOUSE PCI domain-containing protein 2 OS=Mus musculus GN=Pcid2 PE=1 SV=1 94 452 3.0E-45
sp|Q5U3P0|PCID2_DANRE PCI domain-containing protein 2 OS=Danio rerio GN=pcid2 PE=2 SV=1 98 452 1.0E-41
sp|Q2TBN6|PCID2_BOVIN PCI domain-containing protein 2 OS=Bos taurus GN=PCID2 PE=2 SV=1 94 452 6.0E-41
sp|Q54PX7|PCID2_DICDI PCI domain-containing protein 2 homolog OS=Dictyostelium discoideum GN=pcid2 PE=3 SV=1 182 452 4.0E-37
sp|Q8GWE6|EER5_ARATH Enhanced ethylene response protein 5 OS=Arabidopsis thaliana GN=EER5 PE=1 SV=1 86 452 7.0E-37
sp|Q9VTL1|PCID2_DROME PCI domain-containing protein 2 homolog OS=Drosophila melanogaster GN=PCID2 PE=1 SV=2 76 456 9.0E-33
sp|Q60YJ7|PCID2_CAEBR PCI domain-containing protein 2 homolog OS=Caenorhabditis briggsae GN=CBG18211 PE=3 SV=1 189 452 3.0E-27
sp|Q75BU2|CSN12_ASHGO COP9 signalosome complex subunit 12 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CSN12 PE=3 SV=2 122 452 7.0E-27
sp|Q95QU0|PCID2_CAEEL PCI domain-containing protein 2 homolog OS=Caenorhabditis elegans GN=C27F2.10 PE=3 SV=1 122 452 4.0E-26
sp|Q6BGR7|CSN12_DEBHA Protein CSN12 homolog OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CSN12 PE=3 SV=2 186 453 9.0E-24
sp|Q9Y820|YON7_SCHPO PCI domain-containing protein C1105.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1105.07c PE=4 SV=1 71 451 8.0E-23
sp|Q6CPB1|CSN12_KLULA COP9 signalosome complex subunit 12 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CSN12 PE=3 SV=1 124 453 1.0E-17
sp|P47130|CSN12_YEAST Cop9 signalosome complex subunit 12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CSN12 PE=1 SV=1 168 454 8.0E-17
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear export signal 0.5662 0.593 0.1187 0.0508 0.1063 0.0027 0.0452 0.4017 0.2322 0.0029

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2025
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4667
Ophiocordyceps australis map64 (Brazil) OphauB2|4509
Ophiocordyceps camponoti-floridani Ophcf2|03297
Ophiocordyceps camponoti-rufipedis Ophun1|6177
Ophiocordyceps kimflemingae Ophio5|3540 (this protein)
Ophiocordyceps subramaniannii Hirsu2|2289

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3540
MDDLFEAFAQAHAIQNGYLLAQTLSPVAPPEDPRRLVRIWQSTNGHSARGDIKHFIKAQTAHRRSLDPEEVSGWV
EVYFSYWKALGEILAGESGKSSWTYTYEAWRELCSMLIRGYNNSGFEAWTIPSLYLVGKYLRLFAIKSDEERSHT
SFDPSAGASIMQDDFDPEMEKQAQLRDCEQHLKRIFTLCLNDRAPLEESRKWGIYFIINLLFKTYFKLNSASLSR
TILKTLAVYNDKGDMPPLESFPAAQRVTFRYYEGVLLFLEENYVQAEKRLVEAWQLCHKDAKANLERILTYLVPC
KLLTSHVLPTKHLLEPFPRLQRLFLPLSQCIRRGDLRAFDLALQEAENEFVRRRIYLTLERGRDIALRNLLRKVY
IAGGFDDTNETDAAPVRRSRIPVAEFRAAVCMCSGGELIDNDEVECLLANMIYKDLMKGYIHRERGIVVLSKKGA
FPGTGV
Coding >Ophio5|3540
ATGGACGATCTATTCGAGGCGTTTGCCCAGGCGCATGCCATTCAGAACGGCTACTTGCTTGCGCAGACTCTCTCA
CCGGTTGCACCGCCTGAAGATCCTCGCAGGCTGGTGAGAATATGGCAAAGCACAAATGGCCACAGTGCCAGGGGA
GACATCAAGCACTTCATCAAGGCACAGACAGCTCATCGGAGAAGCCTCGACCCAGAAGAAGTCAGTGGTTGGGTG
GAGGTCTACTTTTCTTACTGGAAAGCTCTCGGCGAGATTCTTGCCGGCGAGAGTGGAAAGTCGTCCTGGACCTAT
ACGTACGAGGCCTGGAGGGAACTCTGCTCGATGCTGATTCGGGGTTACAACAACTCTGGCTTCGAGGCCTGGACC
ATTCCCAGTCTGTATCTGGTGGGAAAGTATCTCAGGCTCTTCGCCATCAAGTCCGATGAGGAACGCAGTCACACT
AGTTTCGACCCTTCTGCCGGCGCCTCCATTATGCAGGACGACTTTGATCCCGAGATGGAGAAGCAGGCGCAGCTG
AGAGACTGCGAGCAGCATCTCAAACGCATTTTCACGCTGTGCCTCAACGACAGAGCGCCTTTGGAGGAGTCACGC
AAATGGGGCATCTATTTTATCATCAACCTGCTGTTCAAGACGTACTTCAAACTCAACTCCGCCTCCTTGTCTAGG
ACAATCCTCAAGACCCTGGCCGTCTACAACGATAAAGGAGATATGCCTCCGCTGGAGAGCTTCCCTGCAGCCCAA
CGAGTGACATTTCGGTACTACGAAGGCGTTCTTCTTTTCCTCGAGGAGAACTACGTCCAGGCGGAGAAACGACTC
GTCGAGGCCTGGCAACTCTGCCACAAGGACGCCAAAGCAAACTTGGAGCGTATTTTGACGTATCTCGTTCCCTGC
AAGCTGCTCACGAGCCATGTCCTTCCAACCAAGCATTTGTTGGAGCCGTTCCCTCGCCTTCAGCGGCTATTTTTG
CCACTGTCGCAGTGCATCAGACGTGGCGATTTGCGGGCCTTCGACTTGGCGCTTCAGGAGGCTGAGAACGAATTC
GTCAGACGACGCATTTATCTGACGCTTGAGCGCGGCCGCGACATTGCCCTCCGCAACCTTTTGCGCAAAGTGTAC
ATCGCAGGGGGATTCGACGACACCAACGAGACAGACGCAGCACCAGTGCGGCGATCCCGCATCCCCGTGGCGGAG
TTTCGAGCCGCCGTATGCATGTGCAGCGGCGGAGAGCTCATCGATAATGATGAGGTGGAATGCTTGTTAGCCAAC
ATGATCTACAAGGATCTCATGAAAGGCTACATCCATCGGGAGCGAGGGATTGTCGTGCTGTCTAAAAAAGGTGCT
TTCCCCGGAACTGGGGTT
Transcript >Ophio5|3540
ATGGACGATCTATTCGAGGCGTTTGCCCAGGCGCATGCCATTCAGAACGGCTACTTGCTTGCGCAGACTCTCTCA
CCGGTTGCACCGCCTGAAGATCCTCGCAGGCTGGTGAGAATATGGCAAAGCACAAATGGCCACAGTGCCAGGGGA
GACATCAAGCACTTCATCAAGGCACAGACAGCTCATCGGAGAAGCCTCGACCCAGAAGAAGTCAGTGGTTGGGTG
GAGGTCTACTTTTCTTACTGGAAAGCTCTCGGCGAGATTCTTGCCGGCGAGAGTGGAAAGTCGTCCTGGACCTAT
ACGTACGAGGCCTGGAGGGAACTCTGCTCGATGCTGATTCGGGGTTACAACAACTCTGGCTTCGAGGCCTGGACC
ATTCCCAGTCTGTATCTGGTGGGAAAGTATCTCAGGCTCTTCGCCATCAAGTCCGATGAGGAACGCAGTCACACT
AGTTTCGACCCTTCTGCCGGCGCCTCCATTATGCAGGACGACTTTGATCCCGAGATGGAGAAGCAGGCGCAGCTG
AGAGACTGCGAGCAGCATCTCAAACGCATTTTCACGCTGTGCCTCAACGACAGAGCGCCTTTGGAGGAGTCACGC
AAATGGGGCATCTATTTTATCATCAACCTGCTGTTCAAGACGTACTTCAAACTCAACTCCGCCTCCTTGTCTAGG
ACAATCCTCAAGACCCTGGCCGTCTACAACGATAAAGGAGATATGCCTCCGCTGGAGAGCTTCCCTGCAGCCCAA
CGAGTGACATTTCGGTACTACGAAGGCGTTCTTCTTTTCCTCGAGGAGAACTACGTCCAGGCGGAGAAACGACTC
GTCGAGGCCTGGCAACTCTGCCACAAGGACGCCAAAGCAAACTTGGAGCGTATTTTGACGTATCTCGTTCCCTGC
AAGCTGCTCACGAGCCATGTCCTTCCAACCAAGCATTTGTTGGAGCCGTTCCCTCGCCTTCAGCGGCTATTTTTG
CCACTGTCGCAGTGCATCAGACGTGGCGATTTGCGGGCCTTCGACTTGGCGCTTCAGGAGGCTGAGAACGAATTC
GTCAGACGACGCATTTATCTGACGCTTGAGCGCGGCCGCGACATTGCCCTCCGCAACCTTTTGCGCAAAGTGTAC
ATCGCAGGGGGATTCGACGACACCAACGAGACAGACGCAGCACCAGTGCGGCGATCCCGCATCCCCGTGGCGGAG
TTTCGAGCCGCCGTATGCATGTGCAGCGGCGGAGAGCTCATCGATAATGATGAGGTGGAATGCTTGTTAGCCAAC
ATGATCTACAAGGATCTCATGAAAGGCTACATCCATCGGGAGCGAGGGATTGTCGTGCTGTCTAAAAAAGGTGCT
TTCCCCGGAACTGGGGTTTGA
Gene >Ophio5|3540
ATGGACGATCTATTCGAGGCGTTTGCCCAGGCGCATGCCATTCAGAACGGCTACTTGCTTGCGCAGACTCTCTCA
CCGGTTGCACCGCCTGAAGATCCTCGCAGGCTGGTGAGAATATGGCAAAGCACAAATGGCCACAGTGCCAGGGGA
GACATCAAGCACTTCATCAAGGCACAGACAGCTCATCGGAGAAGCCTCGACCCAGAAGAAGTCAGTGGTTGGGTG
GAGGTCTACTTTTCTTACTGGAAAGCTCTCGGCGAGATTCTTGCCGGCGAGAGTGGAAAGGTCAGCAGTAGCACC
GACTCGTTCGGGAATGTGATGTTGACCGCCGAGGCTCAGTCGTCCTGGACCTATACGTACGAGGCCTGGAGGGAA
CTCTGCTCGATGCTGATTCGGGGTTACAACAACTCTGGCTTCGAGGCCTGGACCATTCCCAGTCTGTATCTGGTG
GGAAAGTATCTCAGGCTCTTCGCCATCAAGTCCGATGAGGAACGCAGTCACACTAGTTTCGACCCTTCTGCCGGC
GCCTCCATTATGCAGGACGACTTTGATCCCGAGATGGAGAAGCAGGCGCAGCTGAGAGACTGCGAGCAGCATCTC
AAACGCATTTTCACGCTGTGCCTCAACGACAGGTATCTAAGGCTGTACTCCACCGGAAACACTGACCCAGCTGAC
GACGGCCCCAGAGCGCCTTTGGAGGAGTCACGCAAATGGGGCATCTATTTTATCATCAACCTGCTGTTCAAGACG
TACTTCAAACTCAACTCCGCCTCCTTGTCTAGGACAATCCTCAAGACCCTGGCCGTCTACAACGATAAAGGAGAT
ATGCCTCCGCTGGAGAGCTTCCCTGCAGCCCAACGAGTGACATTTCGGTACTACGAAGGCGTTCTTCTTTTCCTC
GAGGAGAACTACGTCCAGGTAAACATCCCTTTCCCGCTCCCAGGATACCCAGTATCGCTGATGCAAGGACACAGG
CGGAGAAACGACTCGTCGAGGCCTGGCAACTCTGCCACAAGGACGCCAAAGCAAACTTGGAGTAGGTGTGGCCAA
GACAGCGAACGAAGATGACGCAGCTAACGTTTTACTAGGCGTATTTTGACGTATCTCGTTCCCTGCAAGCTGCTC
ACGAGCCATGTCCTTCCAACCAAGCATTTGTTGGAGCCGTTCCCTCGCCTTCAGCGGCTATTTTTGCCACTGTCG
CAGTGCATCAGACGTGGCGATTTGCGGGCCTTCGACTTGGCGCTTCAGGAGGCTGAGAACGAATTCGTCAGACGA
CGCATTTATCTGACGCTTGAGCGCGGCCGCGACATTGCCCTCCGCAACCTTTTGCGCAAAGTGTACATCGCAGGG
GGATTCGACGACACCAACGAGACAGACGCAGCACCAGTGCGGCGATCCCGCATCCCCGTGGCGGAGTTTCGAGCC
GCCGTATGCATGTGCAGCGGCGGAGAGCTCATCGATAATGATGAGGTGGAATGCTTGTTAGCCAACATGATCTAC
AAGGTGAGGGAGTCACCTTAATATGCTCTCGGCATCGGCACGAGTCACTGACGAGTCATGTTCCATAGGATCTCA
TGAAAGGCTACATCCATCGGGAGCGAGGGATTGTCGTGCTGTCTAAAAAAGGTGCTTTCCCCGGAACTGGGGTTT
GA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail