Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3538
Gene name
Locationscaffold_28:52292..53374
Strand+
Gene length (bp)1082
Transcript length (bp)1002
Coding sequence length (bp)999
Protein length (aa) 333

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P54069|BEM46_SCHPO Protein bem46 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bem46 PE=2 SV=3 1 308 2.0E-13
sp|Q80UX8|ABHDD_MOUSE Alpha/beta hydrolase domain-containing protein 13 OS=Mus musculus GN=Abhd13 PE=2 SV=1 1 328 1.0E-12
sp|Q6IRP4|ABHDD_XENLA Alpha/beta hydrolase domain-containing protein 13 OS=Xenopus laevis GN=abhd13 PE=2 SV=1 1 327 1.0E-11
sp|Q4R766|ABD12_MACFA Monoacylglycerol lipase ABHD12 OS=Macaca fascicularis GN=ABHD12 PE=2 SV=1 61 204 2.0E-11
sp|Q8N2K0|ABD12_HUMAN Monoacylglycerol lipase ABHD12 OS=Homo sapiens GN=ABHD12 PE=1 SV=2 78 204 2.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P54069|BEM46_SCHPO Protein bem46 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bem46 PE=2 SV=3 1 308 2.0E-13
sp|Q80UX8|ABHDD_MOUSE Alpha/beta hydrolase domain-containing protein 13 OS=Mus musculus GN=Abhd13 PE=2 SV=1 1 328 1.0E-12
sp|Q6IRP4|ABHDD_XENLA Alpha/beta hydrolase domain-containing protein 13 OS=Xenopus laevis GN=abhd13 PE=2 SV=1 1 327 1.0E-11
sp|Q4R766|ABD12_MACFA Monoacylglycerol lipase ABHD12 OS=Macaca fascicularis GN=ABHD12 PE=2 SV=1 61 204 2.0E-11
sp|Q8N2K0|ABD12_HUMAN Monoacylglycerol lipase ABHD12 OS=Homo sapiens GN=ABHD12 PE=1 SV=2 78 204 2.0E-11
sp|Q6AYT7|ABD12_RAT Monoacylglycerol lipase ABHD12 OS=Rattus norvegicus GN=Abhd12 PE=2 SV=1 78 204 2.0E-11
sp|Q99LR1|ABD12_MOUSE Monoacylglycerol lipase ABHD12 OS=Mus musculus GN=Abhd12 PE=1 SV=2 78 204 2.0E-11
sp|Q08C93|ABD12_DANRE Monoacylglycerol lipase ABHD12 OS=Danio rerio GN=abhd12 PE=2 SV=1 78 261 2.0E-11
sp|Q08DW9|ABD12_BOVIN Monoacylglycerol lipase ABHD12 OS=Bos taurus GN=ABHD12 PE=2 SV=1 78 204 2.0E-11
sp|B4F753|ABD12_XENTR Monoacylglycerol lipase ABHD12 OS=Xenopus tropicalis GN=abhd12 PE=2 SV=1 78 204 6.0E-11
sp|Q32LS6|ABHDD_DANRE Alpha/beta hydrolase domain-containing protein 13 OS=Danio rerio GN=abhd13 PE=2 SV=1 1 327 7.0E-11
sp|Q5ZIN0|ABD12_CHICK Monoacylglycerol lipase ABHD12 OS=Gallus gallus GN=ABHD12 PE=2 SV=1 78 204 8.0E-11
sp|Q7L211|ABHDD_HUMAN Alpha/beta hydrolase domain-containing protein 13 OS=Homo sapiens GN=ABHD13 PE=2 SV=1 1 328 2.0E-10
sp|Q7Z5M8|AB12B_HUMAN Abhydrolase domain-containing protein 12B OS=Homo sapiens GN=ABHD12B PE=2 SV=1 78 270 1.0E-08
sp|P42840|YN60_YEAST Uncharacterized membrane protein YNL320W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YNL320W PE=1 SV=1 118 308 7.0E-08
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion|Endoplasmic reticulum|Lysosome/Vacuole|Golgi apparatus Signal peptide|Transmembrane domain|Mitochondrial transit peptide 0.2962 0.1376 0.1716 0.096 0.6731 0.019 0.6582 0.6761 0.7017 0.0663

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2027
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4669
Ophiocordyceps australis map64 (Brazil) OphauB2|4507
Ophiocordyceps camponoti-floridani Ophcf2|03299
Ophiocordyceps camponoti-rufipedis Ophun1|6175
Ophiocordyceps kimflemingae Ophio5|3538 (this protein)
Ophiocordyceps subramaniannii Hirsu2|2291

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3538
MLVVFQNVIIYNPFIPPNARSMRITDFARQCRGVEWREVRISSIDGTIIALCVSETPSRGDEMIGNNASFPAHRR
VYILYFQGNASSLPPRLPDISWVLRRLMEDANETVHYTTVCLSYRGYWTSHDRPSEHGINLDARAALQWVARLHR
ERVADDRSAKPVVLLWGQSIGCGFATNLAAMPRTSSSDTNVDALILETPFTNTRAMLQALYPQKWLPYQHLWPFL
RNHLDSWKNLGLIAAKKQRYPPAVYLVEAAKDELVPRDHAAVLQQRCQDLGLVVKRISVAGALHNDVMVRKSGKQ
AIAESITEAVAKAIARSGPEARTDTASDGDELR
Coding >Ophio5|3538
ATGCTGGTCGTCTTCCAGAATGTCATTATATATAACCCATTCATACCGCCCAATGCGAGGAGCATGCGCATTACA
GACTTTGCCCGTCAGTGCCGAGGTGTCGAGTGGCGCGAGGTGCGCATATCGTCTATAGACGGGACCATTATCGCC
TTGTGTGTAAGCGAGACGCCCTCTCGGGGTGACGAAATGATAGGCAACAATGCCAGCTTCCCGGCGCACAGGCGA
GTCTACATTCTCTACTTTCAAGGCAACGCCTCGTCACTGCCCCCTCGCCTTCCGGACATATCCTGGGTATTGCGT
CGTCTGATGGAAGATGCCAACGAAACGGTCCACTACACGACTGTCTGTCTCAGTTATCGCGGATACTGGACGTCA
CACGATCGGCCCTCCGAACACGGCATCAACTTGGATGCCCGAGCCGCGTTGCAATGGGTGGCCCGACTGCATCGC
GAAAGGGTAGCAGACGACCGCTCCGCCAAGCCTGTCGTCCTTCTCTGGGGCCAGAGCATCGGTTGCGGCTTCGCC
ACCAATCTGGCCGCGATGCCAAGAACAAGCTCGTCCGACACGAACGTCGATGCGCTGATATTGGAAACGCCATTT
ACAAACACCCGTGCAATGCTCCAGGCCCTCTACCCTCAAAAGTGGTTGCCTTACCAGCATCTGTGGCCTTTCCTT
CGCAATCATCTTGATAGCTGGAAAAACTTGGGGCTTATAGCTGCGAAGAAGCAGCGCTACCCGCCTGCCGTTTAC
CTTGTCGAAGCCGCCAAGGACGAGCTTGTGCCTCGAGACCACGCCGCGGTCCTCCAACAGCGATGTCAGGATCTT
GGTCTTGTCGTCAAGAGAATTTCGGTGGCGGGAGCGCTCCATAACGATGTCATGGTGCGCAAAAGTGGGAAGCAA
GCCATTGCAGAGTCTATCACTGAGGCCGTGGCGAAAGCCATCGCTCGGTCAGGGCCGGAAGCCAGGACTGATACC
GCCAGCGACGGAGACGAGCTGCGT
Transcript >Ophio5|3538
ATGCTGGTCGTCTTCCAGAATGTCATTATATATAACCCATTCATACCGCCCAATGCGAGGAGCATGCGCATTACA
GACTTTGCCCGTCAGTGCCGAGGTGTCGAGTGGCGCGAGGTGCGCATATCGTCTATAGACGGGACCATTATCGCC
TTGTGTGTAAGCGAGACGCCCTCTCGGGGTGACGAAATGATAGGCAACAATGCCAGCTTCCCGGCGCACAGGCGA
GTCTACATTCTCTACTTTCAAGGCAACGCCTCGTCACTGCCCCCTCGCCTTCCGGACATATCCTGGGTATTGCGT
CGTCTGATGGAAGATGCCAACGAAACGGTCCACTACACGACTGTCTGTCTCAGTTATCGCGGATACTGGACGTCA
CACGATCGGCCCTCCGAACACGGCATCAACTTGGATGCCCGAGCCGCGTTGCAATGGGTGGCCCGACTGCATCGC
GAAAGGGTAGCAGACGACCGCTCCGCCAAGCCTGTCGTCCTTCTCTGGGGCCAGAGCATCGGTTGCGGCTTCGCC
ACCAATCTGGCCGCGATGCCAAGAACAAGCTCGTCCGACACGAACGTCGATGCGCTGATATTGGAAACGCCATTT
ACAAACACCCGTGCAATGCTCCAGGCCCTCTACCCTCAAAAGTGGTTGCCTTACCAGCATCTGTGGCCTTTCCTT
CGCAATCATCTTGATAGCTGGAAAAACTTGGGGCTTATAGCTGCGAAGAAGCAGCGCTACCCGCCTGCCGTTTAC
CTTGTCGAAGCCGCCAAGGACGAGCTTGTGCCTCGAGACCACGCCGCGGTCCTCCAACAGCGATGTCAGGATCTT
GGTCTTGTCGTCAAGAGAATTTCGGTGGCGGGAGCGCTCCATAACGATGTCATGGTGCGCAAAAGTGGGAAGCAA
GCCATTGCAGAGTCTATCACTGAGGCCGTGGCGAAAGCCATCGCTCGGTCAGGGCCGGAAGCCAGGACTGATACC
GCCAGCGACGGAGACGAGCTGCGTTGA
Gene >Ophio5|3538
ATGCTGGTCGTCTTCCAGAATGTCATTATATATAACCCATTCATACCGCCCAATGCGAGGAGCATGCGCATTACA
GACTTTGCCCGTCAGTGCCGAGGTGTCGAGTGGCGCGAGGTGCGCATATCGTCTATAGACGGGACCATTATCGCC
TTGTGTGTAAGCGAGACGCCCTCTCGGGGTGACGAAATGATAGGCAACAATGCCAGCTTCCCGGCGCACAGGCGA
GTCTACATTCTCTACTTTCAAGGTTTGTTTATCGTCTCCGGCCGTAACCGCGCTCGCTCTGCCTCACAGTCACGA
AAATGCTACCACTCACGCCGCTCGCAGGCAACGCCTCGTCACTGCCCCCTCGCCTTCCGGACATATCCTGGGTAT
TGCGTCGTCTGATGGAAGATGCCAACGAAACGGTCCACTACACGACTGTCTGTCTCAGTTATCGCGGATACTGGA
CGTCACACGATCGGCCCTCCGAACACGGCATCAACTTGGATGCCCGAGCCGCGTTGCAATGGGTGGCCCGACTGC
ATCGCGAAAGGGTAGCAGACGACCGCTCCGCCAAGCCTGTCGTCCTTCTCTGGGGCCAGAGCATCGGTTGCGGCT
TCGCCACCAATCTGGCCGCGATGCCAAGAACAAGCTCGTCCGACACGAACGTCGATGCGCTGATATTGGAAACGC
CATTTACAAACACCCGTGCAATGCTCCAGGCCCTCTACCCTCAAAAGTGGTTGCCTTACCAGCATCTGTGGCCTT
TCCTTCGCAATCATCTTGATAGCTGGAAAAACTTGGGGCTTATAGCTGCGAAGAAGCAGCGCTACCCGCCTGCCG
TTTACCTTGTCGAAGCCGCCAAGGACGAGCTTGTGCCTCGAGACCACGCCGCGGTCCTCCAACAGCGATGTCAGG
ATCTTGGTCTTGTCGTCAAGAGAATTTCGGTGGCGGGAGCGCTCCATAACGATGTCATGGTGCGCAAAAGTGGGA
AGCAAGCCATTGCAGAGTCTATCACTGAGGCCGTGGCGAAAGCCATCGCTCGGTCAGGGCCGGAAGCCAGGACTG
ATACCGCCAGCGACGGAGACGAGCTGCGTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail