Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|353
Gene name
Locationscaffold_108:33459..34640
Strand+
Gene length (bp)1181
Transcript length (bp)960
Coding sequence length (bp)957
Protein length (aa) 319

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04045 P34-Arc Arp2/3 complex, 34 kD subunit p34-Arc 1.0E-104 52 301

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14241|ARPC2_SCHPO Actin-related protein 2/3 complex subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=arc2 PE=1 SV=1 1 314 5.0E-120
sp|Q9CVB6|ARPC2_MOUSE Actin-related protein 2/3 complex subunit 2 OS=Mus musculus GN=Arpc2 PE=1 SV=3 1 314 6.0E-91
sp|Q3MHR7|ARPC2_BOVIN Actin-related protein 2/3 complex subunit 2 OS=Bos taurus GN=ARPC2 PE=1 SV=1 1 314 2.0E-90
sp|Q5R5Z5|ARPC2_PONAB Actin-related protein 2/3 complex subunit 2 OS=Pongo abelii GN=ARPC2 PE=2 SV=1 1 314 6.0E-90
sp|O15144|ARPC2_HUMAN Actin-related protein 2/3 complex subunit 2 OS=Homo sapiens GN=ARPC2 PE=1 SV=1 1 314 6.0E-90
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14241|ARPC2_SCHPO Actin-related protein 2/3 complex subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=arc2 PE=1 SV=1 1 314 5.0E-120
sp|Q9CVB6|ARPC2_MOUSE Actin-related protein 2/3 complex subunit 2 OS=Mus musculus GN=Arpc2 PE=1 SV=3 1 314 6.0E-91
sp|Q3MHR7|ARPC2_BOVIN Actin-related protein 2/3 complex subunit 2 OS=Bos taurus GN=ARPC2 PE=1 SV=1 1 314 2.0E-90
sp|Q5R5Z5|ARPC2_PONAB Actin-related protein 2/3 complex subunit 2 OS=Pongo abelii GN=ARPC2 PE=2 SV=1 1 314 6.0E-90
sp|O15144|ARPC2_HUMAN Actin-related protein 2/3 complex subunit 2 OS=Homo sapiens GN=ARPC2 PE=1 SV=1 1 314 6.0E-90
sp|Q7PVX8|ARPC2_ANOGA Probable actin-related protein 2/3 complex subunit 2 OS=Anopheles gambiae GN=Arc-p34 PE=3 SV=2 1 314 6.0E-89
sp|P85970|ARPC2_RAT Actin-related protein 2/3 complex subunit 2 OS=Rattus norvegicus GN=Arpc2 PE=1 SV=1 1 314 2.0E-88
sp|Q9VIM5|ARPC2_DROME Actin-related protein 2/3 complex subunit 2 OS=Drosophila melanogaster GN=Arpc2 PE=2 SV=2 1 315 1.0E-85
sp|Q8WTM6|ARPC2_CAEEL Probable actin-related protein 2/3 complex subunit 2 OS=Caenorhabditis elegans GN=arx-4 PE=3 SV=1 1 317 1.0E-76
sp|P53731|ARPC2_YEAST Actin-related protein 2/3 complex subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARC35 PE=1 SV=1 1 312 2.0E-68
sp|O96623|ARPC2_DICDI Actin-related protein 2/3 complex subunit 2 OS=Dictyostelium discoideum GN=arcB PE=1 SV=1 1 315 7.0E-64
sp|Q8LGI3|ARC2A_ARATH Actin-related protein 2/3 complex subunit 2A OS=Arabidopsis thaliana GN=ARPC2A PE=1 SV=1 1 318 4.0E-35
sp|F4IVU1|ARC2B_ARATH Actin-related protein 2/3 complex subunit 2B OS=Arabidopsis thaliana GN=ARPC2B PE=2 SV=1 1 315 6.0E-19
[Show less]

GO

GO Term Description Terminal node
GO:0015629 actin cytoskeleton Yes
GO:0030833 regulation of actin filament polymerization Yes
GO:0005885 Arp2/3 protein complex Yes
GO:0034314 Arp2/3 complex-mediated actin nucleation Yes
GO:0065007 biological regulation No
GO:0110165 cellular anatomical entity No
GO:0097435 supramolecular fiber organization No
GO:0030832 regulation of actin filament length No
GO:0065008 regulation of biological quality No
GO:0045010 actin nucleation No
GO:0032535 regulation of cellular component size No
GO:0043226 organelle No
GO:0032956 regulation of actin cytoskeleton organization No
GO:0008064 regulation of actin polymerization or depolymerization No
GO:0110053 regulation of actin filament organization No
GO:0032991 protein-containing complex No
GO:0043228 non-membrane-bounded organelle No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0050794 regulation of cellular process No
GO:0051128 regulation of cellular component organization No
GO:0008150 biological_process No
GO:0009987 cellular process No
GO:0090066 regulation of anatomical structure size No
GO:0032970 regulation of actin filament-based process No
GO:0043229 intracellular organelle No
GO:0005575 cellular_component No
GO:0007015 actin filament organization No
GO:0043254 regulation of protein-containing complex assembly No
GO:0016043 cellular component organization No
GO:1902903 regulation of supramolecular fiber organization No
GO:0032271 regulation of protein polymerization No
GO:0005856 cytoskeleton No
GO:0050789 regulation of biological process No
GO:0033043 regulation of organelle organization No
GO:0044087 regulation of cellular component biogenesis No
GO:0051493 regulation of cytoskeleton organization No
GO:0071840 cellular component organization or biogenesis No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6452 0.4757 0.1832 0.0796 0.3064 0.0442 0.1519 0.1163 0.2576 0.0233

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3945
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4912
Ophiocordyceps australis map64 (Brazil) OphauB2|344
Ophiocordyceps camponoti-floridani Ophcf2|04372
Ophiocordyceps camponoti-rufipedis Ophun1|4553
Ophiocordyceps kimflemingae Ophio5|353 (this protein)
Ophiocordyceps subramaniannii Hirsu2|7849

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|353
MLLLDYQNVLIQSVLTERFSGGPATSIDQTVSDFDGVTFHISTPESKTKILLSIQIRCFKDLVQYGAEQVLRREY
GDYLAPVEPGYDFSVMIDLDQLPAEKEERDALALKFALLKRNAMAAPFEQAYEEYYRLKEEASKFTSEEAPQGVR
EGGQVKAIHYRDEEAIYVKASHDRVTVIFSTVFREETDRVFGKVFIQEFVDARRRAIQNAPQVLFRNDPPLELQG
VPGVRDTGTGEVGYVTFVLFPRHLTPQRMPIVISHIQTFRDYFHYHIKASKAYIHSRMRKRTADFLQVLRRARPE
NEERERKTASGRTFKMQGS
Coding >Ophio5|353
ATGCTTCTCCTTGACTATCAGAACGTTCTGATTCAATCGGTTCTGACCGAGAGGTTTTCCGGCGGCCCCGCTACG
TCCATCGACCAGACCGTCTCCGACTTCGATGGCGTCACCTTCCACATATCGACGCCGGAGAGCAAAACCAAGATT
CTTCTCTCAATACAAATAAGGTGCTTTAAGGATCTCGTTCAGTACGGTGCCGAGCAAGTCTTGCGGCGCGAGTAT
GGCGACTACCTGGCACCGGTCGAGCCTGGCTATGACTTCTCCGTCATGATCGATCTCGACCAACTGCCTGCGGAA
AAAGAGGAACGCGATGCTTTGGCATTGAAGTTCGCCTTGCTGAAGCGCAACGCCATGGCGGCCCCTTTCGAGCAA
GCATACGAAGAGTATTACCGATTGAAGGAGGAAGCGTCCAAGTTCACTTCCGAGGAAGCGCCGCAGGGCGTGCGA
GAGGGCGGTCAGGTAAAGGCCATCCACTACCGGGATGAGGAGGCCATCTATGTCAAAGCCAGTCACGACCGAGTC
ACAGTCATCTTTAGCACGGTGTTCCGCGAAGAAACCGACCGTGTGTTTGGCAAAGTGTTTATACAAGAATTTGTT
GATGCTCGCAGGAGAGCCATACAGAACGCACCACAAGTCCTTTTCCGAAACGATCCCCCGCTCGAGCTTCAGGGT
GTTCCGGGGGTACGAGACACGGGTACCGGTGAGGTCGGCTATGTGACATTCGTGTTATTCCCACGGCACCTCACA
CCTCAGCGAATGCCGATTGTCATCTCCCACATACAGACGTTCCGAGACTACTTTCATTATCACATTAAGGCATCC
AAGGCGTACATCCACTCACGAATGCGGAAACGGACAGCCGACTTCCTGCAAGTGCTGCGTCGTGCACGTCCCGAG
AATGAGGAGAGGGAGAGAAAGACTGCCAGCGGTAGGACGTTCAAGATGCAAGGGAGC
Transcript >Ophio5|353
ATGCTTCTCCTTGACTATCAGAACGTTCTGATTCAATCGGTTCTGACCGAGAGGTTTTCCGGCGGCCCCGCTACG
TCCATCGACCAGACCGTCTCCGACTTCGATGGCGTCACCTTCCACATATCGACGCCGGAGAGCAAAACCAAGATT
CTTCTCTCAATACAAATAAGGTGCTTTAAGGATCTCGTTCAGTACGGTGCCGAGCAAGTCTTGCGGCGCGAGTAT
GGCGACTACCTGGCACCGGTCGAGCCTGGCTATGACTTCTCCGTCATGATCGATCTCGACCAACTGCCTGCGGAA
AAAGAGGAACGCGATGCTTTGGCATTGAAGTTCGCCTTGCTGAAGCGCAACGCCATGGCGGCCCCTTTCGAGCAA
GCATACGAAGAGTATTACCGATTGAAGGAGGAAGCGTCCAAGTTCACTTCCGAGGAAGCGCCGCAGGGCGTGCGA
GAGGGCGGTCAGGTAAAGGCCATCCACTACCGGGATGAGGAGGCCATCTATGTCAAAGCCAGTCACGACCGAGTC
ACAGTCATCTTTAGCACGGTGTTCCGCGAAGAAACCGACCGTGTGTTTGGCAAAGTGTTTATACAAGAATTTGTT
GATGCTCGCAGGAGAGCCATACAGAACGCACCACAAGTCCTTTTCCGAAACGATCCCCCGCTCGAGCTTCAGGGT
GTTCCGGGGGTACGAGACACGGGTACCGGTGAGGTCGGCTATGTGACATTCGTGTTATTCCCACGGCACCTCACA
CCTCAGCGAATGCCGATTGTCATCTCCCACATACAGACGTTCCGAGACTACTTTCATTATCACATTAAGGCATCC
AAGGCGTACATCCACTCACGAATGCGGAAACGGACAGCCGACTTCCTGCAAGTGCTGCGTCGTGCACGTCCCGAG
AATGAGGAGAGGGAGAGAAAGACTGCCAGCGGTAGGACGTTCAAGATGCAAGGGAGCTGA
Gene >Ophio5|353
ATGCTTCTCCTTGACTATCAGAACGTTCTGATTCAATCGGTTCTGACCGAGAGGTTTTCCGGGTGGGTACAAGCA
ATCGGACCGGCACCACGCATCTCTGATTTCTCTGCAGCGGCCCCGCTACGTCCATCGACCAGACCGTCTCCGACT
TCGATGGCGTCACCTTCCACATATCGACGCCGGAGAGCAAAACCAAGATTCTTCTCTCAATACAAATAAGGTGCT
TTAAGGATCTCGTTCAGTACGGTGCCGAGCAAGTCTTGCGGCGCGAGTATGGCGACTACCTGGCACCGGTCGAGC
CTGGCTATGACTTCTCCGTCATGATCGATCTCGACCAACTGCCTGCGGAAAAAGGTATACTACAGCGTGTTCACC
TTACGCCGCGTAACGTCCGTAATGCTGACGGCAAGATTCTCAGAGGAACGCGATGCTTTGGCATTGAAGTTCGCC
TTGCTGAAGCGCAACGCCATGGCGGCCCCTTTCGAGCAAGCATACGAAGAGTATTACCGATTGAAGGAGGAAGCG
TCCAAGTTCACTTCCGAGGAAGCGCCGCAGGGCGTGCGAGAGGGCGGTCAGGTAAAGGCCATCCACTACCGGGAT
GAGGAGGCCATCTATGTCAAAGCCAGTCACGACCGAGTCACAGTCATCTTTAGCACGGTGTTCCGCGAAGAAACC
GACCGTGTGTTTGGCAAAGTGTTTATACAAGAATTTGTTGATGCTCGCAGGAGAGCCATACAGAACGCACCACAA
GTCCTTTTCCGAAACGATCCCCCGCTCGAGCTTCAGGGTGTTCCGGGGGTACGAGACACGGGTACCGGTGAGGTC
GGCTATGTGACATTCGGTATGTTCTCTCTCTACGCCCGCGAAATATCCATGCGCAGCTCTGATGGCCGTCATAGT
GTTATTCCCACGGCACCTCACACCTCAGCGAATGCCGATTGTCATCTCCCACATACAGACGTTCCGAGACTACTT
TCATTATCACATTAAGGCATCCAAGGCGTACATCCACTCACGAATGCGGAAACGGACAGCCGACTTCCTGCAAGG
TCCGTGGCCCGGTAAAAACAGTTGATGCGATTGTACTGACTTGTTTAGTGCTGCGTCGTGCACGTCCCGAGAATG
AGGAGAGGGAGAGAAAGACTGCCAGCGGTAGGACGTTCAAGATGCAAGGGAGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail