Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3525
Gene name
Locationscaffold_28:21296..23126
Strand+
Gene length (bp)1830
Transcript length (bp)1656
Coding sequence length (bp)1653
Protein length (aa) 551

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00884 Sulfatase Sulfatase 8.7E-56 26 369
PF12411 Choline_sulf_C Choline sulfatase enzyme C terminal 3.9E-26 481 532
PF01663 Phosphodiest Type I phosphodiesterase / nucleotide pyrophosphatase 3.9E-08 31 314

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O69787|BETC_RHIME Choline-sulfatase OS=Rhizobium meliloti (strain 1021) GN=betC PE=1 SV=2 25 533 7.0E-147
sp|Q5ZK90|ARSK_CHICK Arylsulfatase K OS=Gallus gallus GN=ARSK PE=2 SV=1 17 443 4.0E-35
sp|Q0TUK6|SULF_CLOP1 Arylsulfatase OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=CPF_0221 PE=1 SV=1 25 442 7.0E-34
sp|Q148F3|ARSK_BOVIN Arylsulfatase K OS=Bos taurus GN=ARSK PE=2 SV=1 26 493 9.0E-34
sp|Q08CJ7|ARSK_DANRE Arylsulfatase K OS=Danio rerio GN=arsk PE=2 SV=1 25 493 1.0E-33
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O69787|BETC_RHIME Choline-sulfatase OS=Rhizobium meliloti (strain 1021) GN=betC PE=1 SV=2 25 533 7.0E-147
sp|Q5ZK90|ARSK_CHICK Arylsulfatase K OS=Gallus gallus GN=ARSK PE=2 SV=1 17 443 4.0E-35
sp|Q0TUK6|SULF_CLOP1 Arylsulfatase OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=CPF_0221 PE=1 SV=1 25 442 7.0E-34
sp|Q148F3|ARSK_BOVIN Arylsulfatase K OS=Bos taurus GN=ARSK PE=2 SV=1 26 493 9.0E-34
sp|Q08CJ7|ARSK_DANRE Arylsulfatase K OS=Danio rerio GN=arsk PE=2 SV=1 25 493 1.0E-33
sp|P31447|YIDJ_ECOLI Uncharacterized sulfatase YidJ OS=Escherichia coli (strain K12) GN=yidJ PE=3 SV=1 24 442 1.0E-33
sp|Q32KJ2|ARSK_RAT Arylsulfatase K OS=Rattus norvegicus GN=Arsk PE=2 SV=1 7 493 2.0E-33
sp|Q8XNV1|SULF_CLOPE Arylsulfatase OS=Clostridium perfringens (strain 13 / Type A) GN=CPE0231 PE=3 SV=1 25 442 2.0E-33
sp|Q9D2L1|ARSK_MOUSE Arylsulfatase K OS=Mus musculus GN=Arsk PE=2 SV=2 26 493 4.0E-33
sp|Q0IHJ2|ARSK_XENLA Arylsulfatase K OS=Xenopus laevis GN=arsk PE=2 SV=1 5 503 4.0E-33
sp|Q32KH0|ARSK_CANLF Arylsulfatase K OS=Canis lupus familiaris GN=ARSK PE=2 SV=1 26 473 2.0E-30
sp|Q08890|IDS_MOUSE Iduronate 2-sulfatase OS=Mus musculus GN=Ids PE=2 SV=3 27 377 2.0E-27
sp|P50428|ARSA_MOUSE Arylsulfatase A OS=Mus musculus GN=Arsa PE=1 SV=2 24 467 3.0E-27
sp|Q6UWY0|ARSK_HUMAN Arylsulfatase K OS=Homo sapiens GN=ARSK PE=1 SV=1 26 443 1.0E-26
sp|P22304|IDS_HUMAN Iduronate 2-sulfatase OS=Homo sapiens GN=IDS PE=1 SV=1 27 397 2.0E-26
sp|Q32KJ6|GALNS_RAT N-acetylgalactosamine-6-sulfatase OS=Rattus norvegicus GN=Galns PE=1 SV=1 26 387 4.0E-22
sp|Q8BFR4|GNS_MOUSE N-acetylglucosamine-6-sulfatase OS=Mus musculus GN=Gns PE=1 SV=1 25 404 5.0E-22
sp|Q1LZH9|GNS_BOVIN N-acetylglucosamine-6-sulfatase OS=Bos taurus GN=GNS PE=2 SV=1 25 444 1.0E-21
sp|Q571E4|GALNS_MOUSE N-acetylgalactosamine-6-sulfatase OS=Mus musculus GN=Galns PE=1 SV=2 26 387 2.0E-21
sp|Q8WNQ7|GALNS_PIG N-acetylgalactosamine-6-sulfatase OS=Sus scrofa GN=GALNS PE=2 SV=1 26 387 2.0E-21
sp|P50426|GNS_CAPHI N-acetylglucosamine-6-sulfatase OS=Capra hircus GN=GNS PE=2 SV=1 25 444 4.0E-21
sp|P34059|GALNS_HUMAN N-acetylgalactosamine-6-sulfatase OS=Homo sapiens GN=GALNS PE=1 SV=1 26 387 5.0E-21
sp|Q08DD1|ARSA_BOVIN Arylsulfatase A OS=Bos taurus GN=ARSA PE=2 SV=1 24 467 1.0E-20
sp|Q32KH5|GALNS_CANLF N-acetylgalactosamine-6-sulfatase OS=Canis lupus familiaris GN=GALNS PE=2 SV=1 26 413 2.0E-20
sp|Q9VEX0|SULF1_DROME Extracellular sulfatase SULF-1 homolog OS=Drosophila melanogaster GN=Sulf1 PE=1 SV=1 25 402 4.0E-20
sp|P15586|GNS_HUMAN N-acetylglucosamine-6-sulfatase OS=Homo sapiens GN=GNS PE=1 SV=3 25 404 5.0E-20
sp|P51691|ARS_PSEAE Arylsulfatase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=atsA PE=1 SV=3 25 443 9.0E-20
sp|P15589|STS_RAT Steryl-sulfatase OS=Rattus norvegicus GN=Sts PE=1 SV=2 23 389 2.0E-19
sp|Q90XB6|SULF1_COTCO Extracellular sulfatase Sulf-1 OS=Coturnix coturnix GN=SULF1 PE=1 SV=1 25 492 7.0E-18
sp|Q9C0V7|YHJ2_SCHPO Uncharacterized sulfatase PB10D8.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBPB10D8.02c PE=3 SV=1 19 445 1.0E-17
sp|Q8IWU6|SULF1_HUMAN Extracellular sulfatase Sulf-1 OS=Homo sapiens GN=SULF1 PE=1 SV=1 25 386 4.0E-17
sp|Q60HH5|ARSE_MACFA Arylsulfatase E OS=Macaca fascicularis GN=ARSE PE=2 SV=1 24 428 6.0E-17
sp|P50429|ARSB_MOUSE Arylsulfatase B OS=Mus musculus GN=Arsb PE=1 SV=3 26 382 9.0E-17
sp|Q8K007|SULF1_MOUSE Extracellular sulfatase Sulf-1 OS=Mus musculus GN=Sulf1 PE=2 SV=1 25 386 5.0E-16
sp|P50430|ARSB_RAT Arylsulfatase B OS=Rattus norvegicus GN=Arsb PE=2 SV=2 9 382 1.0E-15
sp|Q8VI60|SULF1_RAT Extracellular sulfatase Sulf-1 OS=Rattus norvegicus GN=Sulf1 PE=1 SV=1 25 386 3.0E-15
sp|Q32KJ9|ARSG_RAT Arylsulfatase G OS=Rattus norvegicus GN=Arsg PE=2 SV=1 25 444 3.0E-15
sp|Q9X759|ATSA_KLEPN Arylsulfatase OS=Klebsiella pneumoniae GN=atsA PE=1 SV=1 25 470 1.0E-14
sp|P50473|ARS_STRPU Arylsulfatase OS=Strongylocentrotus purpuratus PE=2 SV=1 24 378 1.0E-14
sp|P14000|ARS_HEMPU Arylsulfatase OS=Hemicentrotus pulcherrimus PE=1 SV=1 25 418 2.0E-14
sp|P15289|ARSA_HUMAN Arylsulfatase A OS=Homo sapiens GN=ARSA PE=1 SV=3 26 126 8.0E-14
sp|P77318|YDEN_ECOLI Uncharacterized sulfatase YdeN OS=Escherichia coli (strain K12) GN=ydeN PE=3 SV=2 15 393 2.0E-13
sp|P51688|SPHM_HUMAN N-sulphoglucosamine sulphohydrolase OS=Homo sapiens GN=SGSH PE=1 SV=1 24 389 3.0E-13
sp|P08842|STS_HUMAN Steryl-sulfatase OS=Homo sapiens GN=STS PE=1 SV=2 23 126 4.0E-13
sp|P15848|ARSB_HUMAN Arylsulfatase B OS=Homo sapiens GN=ARSB PE=1 SV=1 17 382 5.0E-13
sp|Q21376|SULF1_CAEEL Putative extracellular sulfatase Sulf-1 homolog OS=Caenorhabditis elegans GN=sul-1 PE=3 SV=1 24 399 7.0E-13
sp|Q3TYD4|ARSG_MOUSE Arylsulfatase G OS=Mus musculus GN=Arsg PE=2 SV=1 25 434 2.0E-12
sp|Q96EG1|ARSG_HUMAN Arylsulfatase G OS=Homo sapiens GN=ARSG PE=1 SV=1 23 444 2.0E-12
sp|P33727|ARSB_FELCA Arylsulfatase B OS=Felis catus GN=ARSB PE=2 SV=1 26 382 8.0E-12
sp|Q5FYA8|ARSH_HUMAN Arylsulfatase H OS=Homo sapiens GN=ARSH PE=2 SV=1 24 126 3.0E-11
sp|P15289|ARSA_HUMAN Arylsulfatase A OS=Homo sapiens GN=ARSA PE=1 SV=3 272 453 4.0E-11
sp|P51690|ARSE_HUMAN Arylsulfatase E OS=Homo sapiens GN=ARSE PE=1 SV=2 15 126 4.0E-11
sp|P20713|ATSA_ENTAE Arylsulfatase OS=Enterobacter aerogenes GN=atsA PE=1 SV=1 25 382 6.0E-11
sp|Q32KI9|ARSI_MOUSE Arylsulfatase I OS=Mus musculus GN=Arsi PE=2 SV=1 9 386 8.0E-11
sp|Q32KH8|ARSH_CANLF Arylsulfatase H OS=Canis lupus familiaris GN=ARSH PE=2 SV=1 24 125 2.0E-10
sp|Q32KJ8|ARSI_RAT Arylsulfatase I OS=Rattus norvegicus GN=Arsi PE=2 SV=1 27 386 4.0E-10
sp|P51689|ARSD_HUMAN Arylsulfatase D OS=Homo sapiens GN=ARSD PE=1 SV=2 18 125 6.0E-10
sp|Q32KH7|ARSI_CANLF Arylsulfatase I OS=Canis lupus familiaris GN=ARSI PE=2 SV=2 27 386 8.0E-10
sp|P50427|STS_MOUSE Steryl-sulfatase OS=Mus musculus GN=Sts PE=1 SV=1 27 126 1.0E-09
sp|P50427|STS_MOUSE Steryl-sulfatase OS=Mus musculus GN=Sts PE=1 SV=1 272 388 2.0E-09
sp|Q5FYB1|ARSI_HUMAN Arylsulfatase I OS=Homo sapiens GN=ARSI PE=1 SV=1 27 386 2.0E-09
sp|P54793|ARSF_HUMAN Arylsulfatase F OS=Homo sapiens GN=ARSF PE=1 SV=4 25 125 9.0E-09
sp|Q32KH9|ARSG_CANLF Arylsulfatase G OS=Canis lupus familiaris GN=ARSG PE=2 SV=1 23 126 6.0E-08
sp|P54793|ARSF_HUMAN Arylsulfatase F OS=Homo sapiens GN=ARSF PE=1 SV=4 248 402 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008484 sulfuric ester hydrolase activity Yes
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0016788 hydrolase activity, acting on ester bonds No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3525
MSPDLNSLPASAPLLSPPKGPDGSRPNILYIMADQLAAPQLAMYNSESQIKTPNLDRLAAGSVQFDSAYCPSPLC
APSRMSMITGLLPMKIGAFDNAAQISSEIPTYAHYLRSRGYHTALAGKMHFVGDQLHGYEQRLTSDIYPADFGWA
VNWDEPDARLEWYHNASSILQAGPCGRSNQLDYDEEVMFRSTQYLWDHVRQGPGKRPFALTVSLTHPHDPYTITK
KYWDLYEGVDIALPKARIPKEKLDSHSKRLMHVSDLWDHDLTDDQIRRAKRAYYGSVSYVDDCIGRLLETLRDAG
LTEDTVVIFSGDHGDMLGERGLWYKMSYFESSVRVPLLVNYPRWFEPRHVSQNVSTLDLLPTICDLIGVKPAPYL
PMDGLSMLPHLMGRDGGHDTVLAEYTGEGTVRPIMMIRRGPWKYITCPADEPQLYNLDDDPLELDNLARLRNVAP
QTPAQAAAKAIFAQYDAEAKARWDFDAITAEVLQSQRRRRLVWDALKQGTFTSWDFDPIDDGRTKYIRSTIPLDT
LERRARYPFVDSKSYPCNKTVDSTRG
Coding >Ophio5|3525
ATGTCTCCCGATCTCAACTCGCTGCCGGCTTCGGCGCCTCTCCTCAGCCCTCCCAAGGGCCCAGACGGCTCGCGG
CCCAACATCCTCTACATCATGGCCGATCAACTGGCGGCGCCGCAGCTGGCCATGTACAACAGCGAGTCGCAGATC
AAGACGCCGAATCTGGACCGTCTGGCGGCCGGGTCGGTGCAGTTTGATTCGGCATACTGCCCTTCGCCGCTCTGC
GCTCCCTCTCGCATGAGCATGATTACCGGACTGCTTCCTATGAAGATCGGCGCCTTTGACAACGCGGCCCAGATC
AGCTCCGAGATCCCGACGTATGCGCACTATTTGCGCTCTCGCGGTTATCATACCGCTCTCGCCGGCAAGATGCAC
TTTGTCGGCGACCAGCTGCACGGCTACGAGCAGCGACTCACCAGCGACATCTATCCGGCTGACTTTGGCTGGGCG
GTCAATTGGGACGAGCCCGATGCCCGGCTGGAGTGGTATCACAACGCCAGCTCTATCCTGCAGGCTGGTCCCTGT
GGCCGCAGCAATCAGCTCGACTACGATGAGGAGGTCATGTTCCGCAGCACCCAGTATCTGTGGGACCATGTGCGT
CAGGGGCCGGGGAAGCGGCCCTTTGCCCTGACGGTCTCCCTCACGCACCCTCACGACCCCTACACCATCACCAAA
AAGTACTGGGACCTCTACGAAGGCGTCGACATCGCCCTGCCCAAGGCCCGCATCCCCAAGGAAAAGCTCGACTCG
CACAGCAAGCGATTGATGCACGTCTCCGACCTCTGGGACCACGATCTGACCGACGACCAGATCCGACGGGCCAAG
CGGGCCTACTACGGCTCCGTCAGCTACGTCGACGACTGCATCGGCCGTTTGCTCGAGACGCTGCGTGACGCCGGC
CTGACGGAAGACACCGTCGTCATCTTCAGCGGCGACCACGGCGATATGCTCGGTGAGCGCGGGCTCTGGTACAAG
ATGAGCTACTTCGAGTCGTCGGTGCGCGTGCCGCTGCTCGTCAACTATCCGCGCTGGTTCGAGCCCCGTCACGTG
TCGCAGAACGTCTCGACGCTCGACCTGCTGCCCACCATCTGCGACCTCATCGGCGTCAAGCCGGCCCCCTACCTG
CCCATGGACGGACTCAGCATGCTGCCCCATCTCATGGGCCGCGACGGAGGCCACGACACCGTCCTGGCCGAGTAT
ACGGGCGAGGGCACAGTCCGTCCCATCATGATGATCCGCCGAGGTCCCTGGAAGTACATTACCTGTCCGGCCGAC
GAGCCCCAGCTGTACAACCTCGACGACGATCCGCTCGAGCTCGACAACTTGGCGCGCCTGCGAAACGTCGCGCCT
CAGACCCCCGCCCAGGCCGCCGCCAAAGCCATCTTCGCCCAGTACGACGCCGAGGCCAAGGCCCGGTGGGACTTT
GACGCCATCACCGCCGAGGTGCTGCAGTCGCAGCGCCGCCGTCGCCTGGTGTGGGACGCTCTGAAGCAGGGTACC
TTTACCAGCTGGGACTTTGACCCCATCGACGACGGCCGGACAAAATACATTCGCTCCACGATCCCCCTCGACACG
CTCGAGCGCCGCGCGCGCTACCCGTTTGTCGACTCCAAGTCGTACCCGTGCAACAAGACGGTCGACTCGACCCGC
GGA
Transcript >Ophio5|3525
ATGTCTCCCGATCTCAACTCGCTGCCGGCTTCGGCGCCTCTCCTCAGCCCTCCCAAGGGCCCAGACGGCTCGCGG
CCCAACATCCTCTACATCATGGCCGATCAACTGGCGGCGCCGCAGCTGGCCATGTACAACAGCGAGTCGCAGATC
AAGACGCCGAATCTGGACCGTCTGGCGGCCGGGTCGGTGCAGTTTGATTCGGCATACTGCCCTTCGCCGCTCTGC
GCTCCCTCTCGCATGAGCATGATTACCGGACTGCTTCCTATGAAGATCGGCGCCTTTGACAACGCGGCCCAGATC
AGCTCCGAGATCCCGACGTATGCGCACTATTTGCGCTCTCGCGGTTATCATACCGCTCTCGCCGGCAAGATGCAC
TTTGTCGGCGACCAGCTGCACGGCTACGAGCAGCGACTCACCAGCGACATCTATCCGGCTGACTTTGGCTGGGCG
GTCAATTGGGACGAGCCCGATGCCCGGCTGGAGTGGTATCACAACGCCAGCTCTATCCTGCAGGCTGGTCCCTGT
GGCCGCAGCAATCAGCTCGACTACGATGAGGAGGTCATGTTCCGCAGCACCCAGTATCTGTGGGACCATGTGCGT
CAGGGGCCGGGGAAGCGGCCCTTTGCCCTGACGGTCTCCCTCACGCACCCTCACGACCCCTACACCATCACCAAA
AAGTACTGGGACCTCTACGAAGGCGTCGACATCGCCCTGCCCAAGGCCCGCATCCCCAAGGAAAAGCTCGACTCG
CACAGCAAGCGATTGATGCACGTCTCCGACCTCTGGGACCACGATCTGACCGACGACCAGATCCGACGGGCCAAG
CGGGCCTACTACGGCTCCGTCAGCTACGTCGACGACTGCATCGGCCGTTTGCTCGAGACGCTGCGTGACGCCGGC
CTGACGGAAGACACCGTCGTCATCTTCAGCGGCGACCACGGCGATATGCTCGGTGAGCGCGGGCTCTGGTACAAG
ATGAGCTACTTCGAGTCGTCGGTGCGCGTGCCGCTGCTCGTCAACTATCCGCGCTGGTTCGAGCCCCGTCACGTG
TCGCAGAACGTCTCGACGCTCGACCTGCTGCCCACCATCTGCGACCTCATCGGCGTCAAGCCGGCCCCCTACCTG
CCCATGGACGGACTCAGCATGCTGCCCCATCTCATGGGCCGCGACGGAGGCCACGACACCGTCCTGGCCGAGTAT
ACGGGCGAGGGCACAGTCCGTCCCATCATGATGATCCGCCGAGGTCCCTGGAAGTACATTACCTGTCCGGCCGAC
GAGCCCCAGCTGTACAACCTCGACGACGATCCGCTCGAGCTCGACAACTTGGCGCGCCTGCGAAACGTCGCGCCT
CAGACCCCCGCCCAGGCCGCCGCCAAAGCCATCTTCGCCCAGTACGACGCCGAGGCCAAGGCCCGGTGGGACTTT
GACGCCATCACCGCCGAGGTGCTGCAGTCGCAGCGCCGCCGTCGCCTGGTGTGGGACGCTCTGAAGCAGGGTACC
TTTACCAGCTGGGACTTTGACCCCATCGACGACGGCCGGACAAAATACATTCGCTCCACGATCCCCCTCGACACG
CTCGAGCGCCGCGCGCGCTACCCGTTTGTCGACTCCAAGTCGTACCCGTGCAACAAGACGGTCGACTCGACCCGC
GGATGA
Gene >Ophio5|3525
ATGTCTCCCGATCTCAACTCGCTGCCGGCTTCGGCGCCTCTCCTCAGCCCTCCCAAGGGCCCAGACGGCTCGCGG
CCCAACATCCTCTACATCATGGCCGATCAACTGGCGGCGCCGCAGCTGGCCATGTACAACAGCGAGTCGCAGATC
AAGACGCCGAATCTGGACCGTCTGGCGGCCGGGTCGGTGCAGTTTGATTCGGCATACTGCCCTTCGCCGCTCTGC
GCTCCCTCTCGCATGAGCATGATTACCGGACTGCTTCCTATGAAGATCGGCGCCTTTGACAACGCGGCCCAGATC
AGCTCCGAGATCCCGACGTATGCGCACTATTTGCGCTCTCGCGGTTATCATACCGCTCTCGCCGGCAAGATGCAC
TTTGTCGGCGACCAGCTGCACGGCTACGAGCAGCGACTCACCAGCGACATCTATCCGGCTGACTTTGGCTGGGCG
GTCAATTGGGACGAGCCCGATGCCCGGCTGGAGTGGTATCACAACGCCAGCTCTATCCTGCAGGCTGGTCCCTGT
GGCCGCAGCAATCAGCTCGACTACGATGAGGAGGTCATGTTCCGCAGCACCCAGTATCTGTGGGACCATGTGCGT
CAGGGGCCGGGGAAGCGGCCCTTTGCCCTGACGGTAGGACTCGACGTCGAGAGAGAGAGACGGAGACGGAGAGAA
AGACGGAGAGAGACAGAGAGGAGAGAGATGGAATTGCTGACGCCCTTTTCCTCAGGTCTCCCTCACGCACCCTCA
CGACCCCTACACCATCACCAAAAAGTACTGGGACCTCTACGAAGGCGTCGACATCGCCCTGCCCAAGGCCCGCAT
CCCCAAGGAAAAGCTCGACTCGCACAGCAAGCGATTGATGCACGTCTCCGACCTCTGGGACCACGATCTGACCGA
CGACCAGATCCGACGGGCCAAGCGGGCCTACTACGGCTCCGTCAGCTACGTCGACGACTGCATCGGCCGTTTGCT
CGAGACGCTGCGTGACGCCGGCCTGACGGAAGACACCGTCGTCATCTTCAGCGGCGACCACGGCGATATGCTCGG
TGAGCGCGGGCTCTGGTACAAGATGAGCTACTTCGAGTCGTCGGTGCGCGTGCCGCTGCTCGTCAACTATCCGCG
CTGGTTCGAGCCCCGTCACGTGTCGCAGAACGTCTCGACGCTCGACCTGCTGCCCACCATCTGCGACCTCATCGG
CGTCAAGCCGGCCCCCTACCTGCCCATGGACGGACTCAGCATGCTGCCCCATCTCATGGGCCGCGACGGAGGCCA
CGACACCGTCCTGGCCGAGTATACGGGCGAGGGCACAGTCCGTCCCATCATGATGATCCGCCGAGGTCCCTGGAA
GTACATTACCTGTCCGGCCGACGAGCCCCAGCTGTACAACCTCGACGACGATCCGCTCGAGCTCGACAACTTGGC
GCGCCTGCGAAACGTCGCGCCTCAGACCCCCGCCCAGGCCGCCGCCAAAGCCATCTTCGCCCAGTACGACGCCGA
GGCCAAGGCCCGGTGGGACTTTGACGCCATCACCGCCGAGGTGCTGCAGTCGCAGCGCCGCCGTCGCCTGGTGTG
GGACGCTCTGAAGCAGGGTACCTTTACCAGCTGGGACTTTGACCCCATCGACGACGGCCGGACAAAGTAACTTCT
TTTTGCCTTGCTTGTTGATGGTAGAGTGGGAGAGACGACCAATGGGCGCGGGCTGACACTACTTGCAGATACATT
CGCTCCACGATCCCCCTCGACACGCTCGAGCGCCGCGCGCGCTACCCGTTTGTCGACTCCAAGTCGTACCCGTGC
AACAAGACGGTCGACTCGACCCGCGGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail