Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3524
Gene name
Locationscaffold_28:14390..19449
Strand+
Gene length (bp)5059
Transcript length (bp)4956
Coding sequence length (bp)4953
Protein length (aa) 1651

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00616 RasGAP GTPase-activator protein for Ras-like GTPase 4.3E-49 1023 1231
PF03836 RasGAP_C RasGAP C-terminus 3.9E-47 1431 1571
PF00612 IQ IQ calmodulin-binding motif 1.6E-03 500 520
PF00307 CH Calponin homology (CH) domain 9.4E-11 270 369

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14188|RNG2_SCHPO Ras GTPase-activating-like protein rng2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rng2 PE=1 SV=1 443 1648 0.0E+00
sp|Q5AH02|IQG1_CANAL Ras GTPase-activating-like protein IQG1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=IQG1 PE=1 SV=1 261 1648 2.0E-151
sp|Q3UQ44|IQGA2_MOUSE Ras GTPase-activating-like protein IQGAP2 OS=Mus musculus GN=Iqgap2 PE=1 SV=2 744 1648 1.0E-138
sp|P46940|IQGA1_HUMAN Ras GTPase-activating-like protein IQGAP1 OS=Homo sapiens GN=IQGAP1 PE=1 SV=1 746 1648 2.0E-137
sp|Q9JKF1|IQGA1_MOUSE Ras GTPase-activating-like protein IQGAP1 OS=Mus musculus GN=Iqgap1 PE=1 SV=2 746 1648 2.0E-136
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14188|RNG2_SCHPO Ras GTPase-activating-like protein rng2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rng2 PE=1 SV=1 443 1648 0.0E+00
sp|Q5AH02|IQG1_CANAL Ras GTPase-activating-like protein IQG1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=IQG1 PE=1 SV=1 261 1648 2.0E-151
sp|Q3UQ44|IQGA2_MOUSE Ras GTPase-activating-like protein IQGAP2 OS=Mus musculus GN=Iqgap2 PE=1 SV=2 744 1648 1.0E-138
sp|P46940|IQGA1_HUMAN Ras GTPase-activating-like protein IQGAP1 OS=Homo sapiens GN=IQGAP1 PE=1 SV=1 746 1648 2.0E-137
sp|Q9JKF1|IQGA1_MOUSE Ras GTPase-activating-like protein IQGAP1 OS=Mus musculus GN=Iqgap1 PE=1 SV=2 746 1648 2.0E-136
sp|Q13576|IQGA2_HUMAN Ras GTPase-activating-like protein IQGAP2 OS=Homo sapiens GN=IQGAP2 PE=1 SV=4 746 1648 5.0E-136
sp|Q86VI3|IQGA3_HUMAN Ras GTPase-activating-like protein IQGAP3 OS=Homo sapiens GN=IQGAP3 PE=1 SV=2 739 1649 2.0E-112
sp|Q54K32|RGAA_DICDI Ras GTPase-activating-like protein rgaA OS=Dictyostelium discoideum GN=rgaA PE=1 SV=1 882 1602 1.0E-65
sp|Q12280|IQG1_YEAST Ras GTPase-activating-like protein IQG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IQG1 PE=1 SV=1 533 1649 2.0E-54
sp|O00899|GAPA_DICDI Ras GTPase-activating-like protein gapA OS=Dictyostelium discoideum GN=gapA PE=1 SV=1 882 1650 6.0E-53
sp|O14188|RNG2_SCHPO Ras GTPase-activating-like protein rng2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rng2 PE=1 SV=1 254 419 2.0E-34
sp|Q13576|IQGA2_HUMAN Ras GTPase-activating-like protein IQGAP2 OS=Homo sapiens GN=IQGAP2 PE=1 SV=4 252 417 5.0E-34
sp|Q3UQ44|IQGA2_MOUSE Ras GTPase-activating-like protein IQGAP2 OS=Mus musculus GN=Iqgap2 PE=1 SV=2 252 417 1.0E-33
sp|P46940|IQGA1_HUMAN Ras GTPase-activating-like protein IQGAP1 OS=Homo sapiens GN=IQGAP1 PE=1 SV=1 252 417 2.0E-33
sp|Q9JKF1|IQGA1_MOUSE Ras GTPase-activating-like protein IQGAP1 OS=Mus musculus GN=Iqgap1 PE=1 SV=2 252 417 4.0E-33
sp|P33277|GAP1_SCHPO GTPase-activating protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gap1 PE=3 SV=1 877 1649 1.0E-31
sp|Q86VI3|IQGA3_HUMAN Ras GTPase-activating-like protein IQGAP3 OS=Homo sapiens GN=IQGAP3 PE=1 SV=2 240 417 9.0E-31
sp|Q12280|IQG1_YEAST Ras GTPase-activating-like protein IQG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IQG1 PE=1 SV=1 157 430 7.0E-24
sp|Q10201|YBX7_SCHPO Uncharacterized protein C17D1.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC17D1.07c PE=3 SV=2 261 484 7.0E-15
sp|P14318|MP20_DROME Muscle-specific protein 20 OS=Drosophila melanogaster GN=Mp20 PE=2 SV=2 270 399 2.0E-09
sp|O14185|STG1_SCHPO Transgelin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=stg1 PE=3 SV=1 270 368 5.0E-07
sp|Q24799|MYPH_ECHGR Myophilin OS=Echinococcus granulosus PE=2 SV=1 270 368 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0043087 regulation of GTPase activity Yes
GO:0005488 binding No
GO:0065007 biological regulation No
GO:0065009 regulation of molecular function No
GO:0051336 regulation of hydrolase activity No
GO:0003674 molecular_function No
GO:0050790 regulation of catalytic activity No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 58 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3524
MSSQPQPLRKLHAVDLPSPVRDILNQYPSLTSTSASAGSATKPPRQHCRGQSDVLARARTFEAGAMDVSIASSPG
SVRGPNRQSLCLLPQAPASSPTRPPQTPPGRKALTHERGKSIDVSRLALKLADGPASPVSPSPPRPKSARPISML
LSRTDFGLAASTAAPHNNASQPNHHAHIGRPDLELLGKSSTRELRTLSRLAQSESADGFTITSSAQEVVGLRGRR
RLQRMDKPSGGRDARTAGYSWEGRNWMDKQRQFLQAYEYLCHIGEAKEWVEDVTSKSLPPIVELEEALRDGVTLA
EIVEALNPDKRYRIFHHPKLQYRHSDNIAIFFRYLDEVELPDLFRFELIDLYEKKNIPKVIYCIHALSWLLFRKG
IVDFRIGNLVGQLEFEHHELEAMQKGLDKLGANMPSFGNMGADFGVPEPEPEPQETEEERIDRELGEVKESIVEL
QAQSRGSILRIRLGNTMQRLWDGEEWLVDLQARIRGDFTRQIMRYRLQMRRSAILVQSSVRGFLVRRRLRQNDQS
CKASEPLVLGLQSVIRANKVRGELRDLRSLLEACKGPVREIQATSRGFLARKDHAAQQRETRATSEPVRKLQAAA
RGSLLRAQVDDQLRLLDDQAGAVTHAQAAARGSQTRARLACERDNLRAFESTWTAFQASTRGAAARSRYSALNAE
LEQQAGGVAQLQSLMRAAMVRREVTSQLDELESNSEDMVAVQSHIRGVLQRRDVSALRRRLDRHVAPTVDLQAHG
RGQLVRQHHEALVDELHSHDDAIAAFQAILKAMVVRAQVEDLVAELLEEEDAIVSAQAAAKGFLVRAQFEEKKRY
FNENMQKVVKIQSFVRAKVQGEAYKSLTTGKNPPVNAVKNFVHLLNDSDFDFNEEVEFERIRKTVVQQVRQNEML
EQYIDQLDIKIALLVKNKITLDEVVRHQHNYGGSSVGLLANSSMSSGNQFDLKALNKSSRKKLESYQQLFFSLQT
QPQYLARLFKRMREQGTAEKECKRIELLIMSLFGYAQKRREEYYLLKLIARSIREEIEGAAMVHEYVRGNYFWAR
LLGNYTRSPRDRKYLRSLLGPLIRDNFIEDPALDLESDPMQIYRSAINNEELRTGRPDQRPLDVPREVAIRDPET
RRLFIDHLRDLREICDQFFTALEDLLHKMPYGLRFLCGQMFDTLCQHFNREPQGQLLQVVANWLWKFYLQPALTS
PEQVGVVEKTLSPLQKRNLGEVAKVIGQVASGRPFGGDNIYLQPLNAFVTESMERLRLMMRELMAVPDAERTFDI
DEFNDLYAKNKPTLYIKMTDIFAIHNLVAAELAAMCPTRDDVLGEIMSDLGSAKSNENEMNAAGSSDIHMFLTPK
LHDVDDPEEDVKALFMETKRCVLYIIRVQTGANLLEILVKPITAEDEQRWRDLVRDDFSDDSETRGAYSDANMAD
VTRMTYHELKRTALENVMRLEQMGRISKHNLYQDVLNAIASDIRTKSRRRVQRQRELEGVRLTLGNLHEKAKYLE
QQRRSYDDYIEHAMATLQNKKGKKRFLLPFTKQYNHQRELERSGRVPKFGSFKYSARALSDKGVLVSWSGLGDRD
VDKINLTISCDEVGIFALEGSRGHIQMPGASALVSIEDLLQAQFESHQFMHIFEGNLKLNVNLLLHLIYKKFYRT
A
Coding >Ophio5|3524
ATGTCCTCCCAGCCTCAGCCGCTCCGCAAGCTGCACGCCGTCGACCTTCCTTCCCCCGTCCGCGACATCCTCAAC
CAATATCCCTCCCTAACATCAACATCTGCATCTGCTGGCAGCGCCACTAAGCCCCCTCGACAGCACTGCCGCGGT
CAGAGCGATGTCCTAGCTCGCGCCCGCACCTTCGAAGCCGGCGCAATGGACGTCTCCATTGCCTCCTCCCCCGGA
AGCGTTCGCGGCCCCAATCGCCAGTCGCTTTGTCTCCTCCCTCAGGCGCCGGCCTCGTCTCCGACCCGTCCGCCC
CAGACTCCCCCGGGTCGCAAAGCCTTGACACATGAGCGCGGTAAGAGCATCGACGTCAGCAGGCTGGCCTTGAAG
CTGGCCGACGGCCCTGCGTCCCCCGTCTCGCCTTCGCCTCCCCGTCCCAAGTCTGCTCGGCCCATCTCGATGCTG
CTGTCCCGAACCGATTTTGGCCTCGCAGCCAGCACCGCCGCCCCGCACAACAACGCTTCGCAGCCCAATCACCAT
GCTCACATTGGCCGTCCCGACCTCGAGCTGCTCGGGAAATCGTCCACGCGAGAGCTGCGCACTCTTTCGCGCCTC
GCCCAGTCCGAGTCCGCCGATGGCTTCACCATTACCTCCTCCGCCCAGGAGGTCGTGGGGCTGCGCGGTCGGCGC
CGACTGCAGCGCATGGACAAGCCGAGTGGTGGCCGCGATGCCAGGACGGCCGGCTACAGTTGGGAAGGCCGCAAC
TGGATGGACAAGCAACGTCAGTTTCTTCAGGCCTACGAGTACCTCTGCCACATAGGAGAGGCCAAGGAATGGGTG
GAAGACGTCACCAGCAAGTCCCTGCCTCCCATAGTCGAGCTTGAAGAGGCCCTCCGAGACGGAGTTACGCTGGCC
GAGATTGTCGAAGCCCTCAATCCCGACAAACGTTACCGGATATTCCACCACCCCAAGCTTCAATACCGCCACTCC
GACAACATCGCCATCTTCTTTCGTTATCTAGACGAGGTCGAGCTCCCTGACCTCTTCCGATTCGAGCTCATAGAC
CTCTACGAGAAGAAAAACATACCAAAGGTTATATACTGTATACACGCCCTGAGTTGGCTGCTGTTCCGCAAAGGC
ATCGTCGACTTCCGGATAGGCAACCTCGTCGGCCAGCTCGAGTTTGAACACCACGAGCTCGAGGCCATGCAAAAG
GGCCTCGATAAGCTGGGGGCCAACATGCCGAGCTTCGGTAACATGGGGGCCGACTTTGGCGTGCCTGAACCCGAG
CCCGAACCGCAAGAAACGGAAGAGGAGAGGATCGATCGGGAGTTGGGAGAGGTCAAGGAGTCCATCGTCGAATTG
CAGGCGCAAAGTCGAGGTTCCATACTGCGAATTCGCCTCGGCAACACGATGCAGCGCCTCTGGGACGGTGAGGAA
TGGCTGGTCGATCTGCAAGCACGTATTCGGGGTGACTTCACGCGTCAAATCATGCGCTACCGGCTCCAGATGCGA
CGGTCCGCGATCCTCGTCCAGAGTTCCGTGCGCGGATTTCTCGTCCGCCGAAGGCTGAGGCAGAACGACCAGTCC
TGCAAGGCCTCGGAACCGCTCGTCTTGGGCTTGCAAAGTGTGATACGCGCCAACAAAGTCCGCGGCGAGCTTCGC
GACCTCAGGTCCCTCTTGGAGGCGTGCAAGGGGCCTGTCCGGGAAATACAAGCGACTTCCCGAGGATTCCTGGCC
CGCAAGGACCACGCAGCGCAGCAGCGAGAGACACGGGCGACATCCGAGCCCGTCCGGAAACTCCAGGCCGCTGCC
CGCGGGTCGCTGTTGAGGGCACAAGTCGACGACCAGCTTCGACTCCTGGACGACCAAGCCGGTGCCGTTACTCAT
GCGCAGGCTGCTGCGAGGGGCTCGCAGACCAGAGCCCGGCTTGCTTGCGAACGCGACAATCTGCGGGCATTCGAA
TCGACGTGGACGGCGTTCCAGGCCTCGACTCGGGGAGCTGCCGCCCGAAGCCGCTATTCGGCGCTGAACGCGGAG
TTGGAGCAACAGGCGGGAGGCGTCGCCCAACTCCAGTCGTTGATGCGAGCCGCTATGGTACGGAGAGAGGTAACA
AGTCAACTGGACGAGTTAGAGTCGAACAGCGAAGACATGGTGGCTGTCCAATCCCATATTCGAGGCGTGCTGCAA
AGGAGGGACGTCTCTGCGCTCCGGCGACGCCTTGACCGCCACGTTGCTCCGACGGTCGACCTGCAGGCACACGGC
CGAGGACAGCTTGTCCGTCAACATCACGAAGCCCTAGTAGACGAGCTGCACTCTCACGACGACGCCATTGCGGCC
TTCCAGGCCATTCTCAAGGCCATGGTTGTGCGAGCACAAGTCGAGGACCTCGTCGCCGAGTTGCTAGAGGAAGAG
GACGCCATCGTTTCCGCCCAGGCCGCGGCCAAGGGCTTCCTCGTCCGCGCTCAGTTCGAGGAGAAGAAGCGGTAC
TTCAACGAGAACATGCAGAAAGTGGTCAAGATCCAGAGTTTCGTGCGTGCCAAGGTGCAGGGCGAAGCGTACAAG
AGCCTCACGACGGGCAAGAACCCGCCGGTCAACGCGGTCAAGAACTTTGTGCACCTGCTCAACGACAGCGACTTC
GACTTTAACGAGGAGGTCGAGTTTGAGAGGATACGGAAGACGGTGGTGCAGCAGGTGCGACAGAACGAGATGCTG
GAGCAGTACATTGACCAGCTCGACATCAAGATCGCCCTCCTGGTGAAGAACAAGATTACGCTCGACGAGGTTGTG
CGTCATCAGCACAACTACGGGGGCAGCTCGGTCGGGCTCCTGGCCAACTCGTCCATGTCCTCTGGCAACCAGTTC
GACCTGAAGGCTCTCAATAAAAGCTCGAGGAAGAAGCTTGAGTCGTACCAGCAGCTCTTCTTCAGCCTGCAGACG
CAGCCGCAATACCTGGCCCGGCTCTTCAAGCGCATGCGCGAGCAGGGGACGGCGGAGAAGGAGTGTAAGAGGATC
GAGCTTCTCATCATGAGTCTCTTTGGCTACGCGCAGAAGCGACGAGAGGAATACTACCTGCTGAAGCTGATTGCG
AGATCGATCCGGGAGGAGATTGAGGGCGCTGCCATGGTACACGAGTACGTCCGAGGCAACTACTTTTGGGCGAGG
CTGCTGGGCAACTACACGCGCTCGCCGAGAGACCGCAAATATCTGCGAAGCCTGCTGGGGCCGCTGATACGGGAC
AACTTCATCGAAGACCCGGCCCTGGACCTGGAAAGCGATCCGATGCAGATTTACCGGTCGGCCATCAACAACGAA
GAGCTGCGGACCGGACGGCCGGACCAACGGCCGCTGGATGTGCCTCGCGAGGTGGCCATCCGGGACCCCGAAACG
AGACGGCTCTTCATCGACCACCTGCGCGATCTCCGCGAGATCTGCGACCAGTTCTTTACGGCGCTCGAGGATCTG
CTGCACAAGATGCCCTACGGCCTCCGCTTCCTGTGCGGGCAGATGTTCGACACGCTCTGCCAGCACTTCAACAGG
GAGCCGCAGGGCCAGCTGCTGCAGGTTGTGGCCAATTGGCTGTGGAAGTTTTACCTCCAGCCGGCTCTGACGTCG
CCGGAGCAGGTGGGCGTGGTGGAGAAGACGCTGAGCCCGCTGCAAAAGAGGAACCTGGGCGAGGTGGCCAAGGTG
ATCGGGCAGGTGGCGTCAGGGCGGCCGTTTGGGGGCGACAACATCTACCTGCAGCCCCTGAACGCGTTTGTGACG
GAGTCGATGGAGCGGCTGCGGCTGATGATGAGGGAGCTGATGGCGGTGCCGGATGCGGAGCGGACATTCGACATT
GACGAGTTCAACGACCTCTACGCCAAGAACAAGCCGACGCTGTACATCAAGATGACGGACATCTTCGCCATCCAC
AACCTGGTGGCGGCAGAGCTGGCGGCCATGTGTCCGACGCGCGACGACGTGCTCGGCGAAATCATGAGCGACCTC
GGGAGCGCCAAGAGCAACGAGAACGAGATGAACGCGGCCGGGTCGTCGGACATTCACATGTTCCTGACGCCCAAG
CTCCACGACGTCGACGACCCCGAGGAGGACGTCAAGGCGCTGTTCATGGAGACGAAGCGCTGCGTGCTGTACATT
ATTCGCGTGCAGACGGGCGCCAACCTCCTGGAGATCTTGGTCAAGCCCATCACGGCGGAAGACGAGCAGCGGTGG
CGGGACCTGGTCCGCGACGACTTCTCCGACGACAGCGAGACGCGGGGCGCCTACTCGGACGCCAACATGGCGGAC
GTGACGCGGATGACGTACCATGAGCTGAAGCGGACGGCGCTGGAGAACGTGATGCGGCTGGAGCAGATGGGGCGC
ATCTCCAAGCACAACCTGTACCAGGACGTGCTCAACGCCATCGCCAGCGACATCCGGACCAAGAGCCGGCGGCGG
GTGCAGAGACAGAGGGAGCTCGAGGGCGTGCGGCTGACGCTGGGCAACCTGCACGAGAAGGCCAAGTACCTGGAG
CAGCAGCGGAGGAGCTACGACGACTACATTGAGCACGCCATGGCGACGCTGCAGAACAAGAAGGGGAAGAAGCGA
TTCCTGCTGCCCTTTACCAAGCAGTACAACCACCAGCGCGAACTGGAGCGCAGTGGGCGCGTGCCCAAGTTCGGC
AGCTTCAAGTATAGCGCGCGGGCGCTGTCGGACAAGGGGGTGCTCGTCTCTTGGAGCGGGCTCGGCGACCGCGAC
GTGGACAAGATCAACCTGACCATCTCGTGCGACGAGGTGGGCATCTTTGCGCTCGAGGGGTCGCGTGGGCACATC
CAGATGCCCGGGGCCAGCGCGCTGGTGTCCATCGAGGACCTGCTGCAGGCGCAGTTTGAGTCGCACCAGTTTATG
CACATCTTTGAGGGCAACTTGAAGCTCAACGTCAACTTGCTGCTGCATCTCATCTACAAGAAGTTTTACCGGACG
GCG
Transcript >Ophio5|3524
ATGTCCTCCCAGCCTCAGCCGCTCCGCAAGCTGCACGCCGTCGACCTTCCTTCCCCCGTCCGCGACATCCTCAAC
CAATATCCCTCCCTAACATCAACATCTGCATCTGCTGGCAGCGCCACTAAGCCCCCTCGACAGCACTGCCGCGGT
CAGAGCGATGTCCTAGCTCGCGCCCGCACCTTCGAAGCCGGCGCAATGGACGTCTCCATTGCCTCCTCCCCCGGA
AGCGTTCGCGGCCCCAATCGCCAGTCGCTTTGTCTCCTCCCTCAGGCGCCGGCCTCGTCTCCGACCCGTCCGCCC
CAGACTCCCCCGGGTCGCAAAGCCTTGACACATGAGCGCGGTAAGAGCATCGACGTCAGCAGGCTGGCCTTGAAG
CTGGCCGACGGCCCTGCGTCCCCCGTCTCGCCTTCGCCTCCCCGTCCCAAGTCTGCTCGGCCCATCTCGATGCTG
CTGTCCCGAACCGATTTTGGCCTCGCAGCCAGCACCGCCGCCCCGCACAACAACGCTTCGCAGCCCAATCACCAT
GCTCACATTGGCCGTCCCGACCTCGAGCTGCTCGGGAAATCGTCCACGCGAGAGCTGCGCACTCTTTCGCGCCTC
GCCCAGTCCGAGTCCGCCGATGGCTTCACCATTACCTCCTCCGCCCAGGAGGTCGTGGGGCTGCGCGGTCGGCGC
CGACTGCAGCGCATGGACAAGCCGAGTGGTGGCCGCGATGCCAGGACGGCCGGCTACAGTTGGGAAGGCCGCAAC
TGGATGGACAAGCAACGTCAGTTTCTTCAGGCCTACGAGTACCTCTGCCACATAGGAGAGGCCAAGGAATGGGTG
GAAGACGTCACCAGCAAGTCCCTGCCTCCCATAGTCGAGCTTGAAGAGGCCCTCCGAGACGGAGTTACGCTGGCC
GAGATTGTCGAAGCCCTCAATCCCGACAAACGTTACCGGATATTCCACCACCCCAAGCTTCAATACCGCCACTCC
GACAACATCGCCATCTTCTTTCGTTATCTAGACGAGGTCGAGCTCCCTGACCTCTTCCGATTCGAGCTCATAGAC
CTCTACGAGAAGAAAAACATACCAAAGGTTATATACTGTATACACGCCCTGAGTTGGCTGCTGTTCCGCAAAGGC
ATCGTCGACTTCCGGATAGGCAACCTCGTCGGCCAGCTCGAGTTTGAACACCACGAGCTCGAGGCCATGCAAAAG
GGCCTCGATAAGCTGGGGGCCAACATGCCGAGCTTCGGTAACATGGGGGCCGACTTTGGCGTGCCTGAACCCGAG
CCCGAACCGCAAGAAACGGAAGAGGAGAGGATCGATCGGGAGTTGGGAGAGGTCAAGGAGTCCATCGTCGAATTG
CAGGCGCAAAGTCGAGGTTCCATACTGCGAATTCGCCTCGGCAACACGATGCAGCGCCTCTGGGACGGTGAGGAA
TGGCTGGTCGATCTGCAAGCACGTATTCGGGGTGACTTCACGCGTCAAATCATGCGCTACCGGCTCCAGATGCGA
CGGTCCGCGATCCTCGTCCAGAGTTCCGTGCGCGGATTTCTCGTCCGCCGAAGGCTGAGGCAGAACGACCAGTCC
TGCAAGGCCTCGGAACCGCTCGTCTTGGGCTTGCAAAGTGTGATACGCGCCAACAAAGTCCGCGGCGAGCTTCGC
GACCTCAGGTCCCTCTTGGAGGCGTGCAAGGGGCCTGTCCGGGAAATACAAGCGACTTCCCGAGGATTCCTGGCC
CGCAAGGACCACGCAGCGCAGCAGCGAGAGACACGGGCGACATCCGAGCCCGTCCGGAAACTCCAGGCCGCTGCC
CGCGGGTCGCTGTTGAGGGCACAAGTCGACGACCAGCTTCGACTCCTGGACGACCAAGCCGGTGCCGTTACTCAT
GCGCAGGCTGCTGCGAGGGGCTCGCAGACCAGAGCCCGGCTTGCTTGCGAACGCGACAATCTGCGGGCATTCGAA
TCGACGTGGACGGCGTTCCAGGCCTCGACTCGGGGAGCTGCCGCCCGAAGCCGCTATTCGGCGCTGAACGCGGAG
TTGGAGCAACAGGCGGGAGGCGTCGCCCAACTCCAGTCGTTGATGCGAGCCGCTATGGTACGGAGAGAGGTAACA
AGTCAACTGGACGAGTTAGAGTCGAACAGCGAAGACATGGTGGCTGTCCAATCCCATATTCGAGGCGTGCTGCAA
AGGAGGGACGTCTCTGCGCTCCGGCGACGCCTTGACCGCCACGTTGCTCCGACGGTCGACCTGCAGGCACACGGC
CGAGGACAGCTTGTCCGTCAACATCACGAAGCCCTAGTAGACGAGCTGCACTCTCACGACGACGCCATTGCGGCC
TTCCAGGCCATTCTCAAGGCCATGGTTGTGCGAGCACAAGTCGAGGACCTCGTCGCCGAGTTGCTAGAGGAAGAG
GACGCCATCGTTTCCGCCCAGGCCGCGGCCAAGGGCTTCCTCGTCCGCGCTCAGTTCGAGGAGAAGAAGCGGTAC
TTCAACGAGAACATGCAGAAAGTGGTCAAGATCCAGAGTTTCGTGCGTGCCAAGGTGCAGGGCGAAGCGTACAAG
AGCCTCACGACGGGCAAGAACCCGCCGGTCAACGCGGTCAAGAACTTTGTGCACCTGCTCAACGACAGCGACTTC
GACTTTAACGAGGAGGTCGAGTTTGAGAGGATACGGAAGACGGTGGTGCAGCAGGTGCGACAGAACGAGATGCTG
GAGCAGTACATTGACCAGCTCGACATCAAGATCGCCCTCCTGGTGAAGAACAAGATTACGCTCGACGAGGTTGTG
CGTCATCAGCACAACTACGGGGGCAGCTCGGTCGGGCTCCTGGCCAACTCGTCCATGTCCTCTGGCAACCAGTTC
GACCTGAAGGCTCTCAATAAAAGCTCGAGGAAGAAGCTTGAGTCGTACCAGCAGCTCTTCTTCAGCCTGCAGACG
CAGCCGCAATACCTGGCCCGGCTCTTCAAGCGCATGCGCGAGCAGGGGACGGCGGAGAAGGAGTGTAAGAGGATC
GAGCTTCTCATCATGAGTCTCTTTGGCTACGCGCAGAAGCGACGAGAGGAATACTACCTGCTGAAGCTGATTGCG
AGATCGATCCGGGAGGAGATTGAGGGCGCTGCCATGGTACACGAGTACGTCCGAGGCAACTACTTTTGGGCGAGG
CTGCTGGGCAACTACACGCGCTCGCCGAGAGACCGCAAATATCTGCGAAGCCTGCTGGGGCCGCTGATACGGGAC
AACTTCATCGAAGACCCGGCCCTGGACCTGGAAAGCGATCCGATGCAGATTTACCGGTCGGCCATCAACAACGAA
GAGCTGCGGACCGGACGGCCGGACCAACGGCCGCTGGATGTGCCTCGCGAGGTGGCCATCCGGGACCCCGAAACG
AGACGGCTCTTCATCGACCACCTGCGCGATCTCCGCGAGATCTGCGACCAGTTCTTTACGGCGCTCGAGGATCTG
CTGCACAAGATGCCCTACGGCCTCCGCTTCCTGTGCGGGCAGATGTTCGACACGCTCTGCCAGCACTTCAACAGG
GAGCCGCAGGGCCAGCTGCTGCAGGTTGTGGCCAATTGGCTGTGGAAGTTTTACCTCCAGCCGGCTCTGACGTCG
CCGGAGCAGGTGGGCGTGGTGGAGAAGACGCTGAGCCCGCTGCAAAAGAGGAACCTGGGCGAGGTGGCCAAGGTG
ATCGGGCAGGTGGCGTCAGGGCGGCCGTTTGGGGGCGACAACATCTACCTGCAGCCCCTGAACGCGTTTGTGACG
GAGTCGATGGAGCGGCTGCGGCTGATGATGAGGGAGCTGATGGCGGTGCCGGATGCGGAGCGGACATTCGACATT
GACGAGTTCAACGACCTCTACGCCAAGAACAAGCCGACGCTGTACATCAAGATGACGGACATCTTCGCCATCCAC
AACCTGGTGGCGGCAGAGCTGGCGGCCATGTGTCCGACGCGCGACGACGTGCTCGGCGAAATCATGAGCGACCTC
GGGAGCGCCAAGAGCAACGAGAACGAGATGAACGCGGCCGGGTCGTCGGACATTCACATGTTCCTGACGCCCAAG
CTCCACGACGTCGACGACCCCGAGGAGGACGTCAAGGCGCTGTTCATGGAGACGAAGCGCTGCGTGCTGTACATT
ATTCGCGTGCAGACGGGCGCCAACCTCCTGGAGATCTTGGTCAAGCCCATCACGGCGGAAGACGAGCAGCGGTGG
CGGGACCTGGTCCGCGACGACTTCTCCGACGACAGCGAGACGCGGGGCGCCTACTCGGACGCCAACATGGCGGAC
GTGACGCGGATGACGTACCATGAGCTGAAGCGGACGGCGCTGGAGAACGTGATGCGGCTGGAGCAGATGGGGCGC
ATCTCCAAGCACAACCTGTACCAGGACGTGCTCAACGCCATCGCCAGCGACATCCGGACCAAGAGCCGGCGGCGG
GTGCAGAGACAGAGGGAGCTCGAGGGCGTGCGGCTGACGCTGGGCAACCTGCACGAGAAGGCCAAGTACCTGGAG
CAGCAGCGGAGGAGCTACGACGACTACATTGAGCACGCCATGGCGACGCTGCAGAACAAGAAGGGGAAGAAGCGA
TTCCTGCTGCCCTTTACCAAGCAGTACAACCACCAGCGCGAACTGGAGCGCAGTGGGCGCGTGCCCAAGTTCGGC
AGCTTCAAGTATAGCGCGCGGGCGCTGTCGGACAAGGGGGTGCTCGTCTCTTGGAGCGGGCTCGGCGACCGCGAC
GTGGACAAGATCAACCTGACCATCTCGTGCGACGAGGTGGGCATCTTTGCGCTCGAGGGGTCGCGTGGGCACATC
CAGATGCCCGGGGCCAGCGCGCTGGTGTCCATCGAGGACCTGCTGCAGGCGCAGTTTGAGTCGCACCAGTTTATG
CACATCTTTGAGGGCAACTTGAAGCTCAACGTCAACTTGCTGCTGCATCTCATCTACAAGAAGTTTTACCGGACG
GCGTGA
Gene >Ophio5|3524
ATGTCCTCCCAGCCTCAGCCGCTCCGCAAGCTGCACGCCGTCGACCTTCCTTCCCCCGTCCGCGACATCCTCAAC
CAATATCCCTCCCTAACATCAACATCTGCATCTGCTGGCAGCGCCACTAAGCCCCCTCGACAGCACTGCCGCGGT
CAGAGCGATGTCCTAGCTCGCGCCCGCACCTTCGAAGCCGGCGCAATGGACGTCTCCATTGCCTCCTCCCCCGGA
AGCGTTCGCGGCCCCAATCGCCAGTCGCTTTGTCTCCTCCCTCAGGCGCCGGCCTCGTCTCCGACCCGTCCGCCC
CAGACTCCCCCGGGTCGCAAAGCCTTGACACATGAGCGCGGTAAGAGCATCGACGTCAGCAGGCTGGCCTTGAAG
CTGGCCGACGGCCCTGCGTCCCCCGTCTCGCCTTCGCCTCCCCGTCCCAAGTCTGCTCGGCCCATCTCGATGCTG
CTGTCCCGAACCGATTTTGGCCTCGCAGCCAGCACCGCCGCCCCGCACAACAACGCTTCGCAGCCCAATCACCAT
GCTCACATTGGCCGTCCCGACCTCGAGCTGCTCGGGAAATCGTCCACGCGAGAGCTGCGCACTCTTTCGCGCCTC
GCCCAGTCCGAGTCCGCCGATGGCTTCACCATTACCTCCTCCGCCCAGGAGGTCGTGGGGCTGCGCGGTCGGCGC
CGACTGCAGCGCATGGACAAGCCGAGTGGTGGCCGCGATGCCAGGACGGCCGGCTACAGTTGGGAAGGCCGCAAC
TGGATGGACAAGCAACGTCAGTTTCTTCAGGCCTACGAGTACCTCTGCCACATAGGAGAGGCCAAGGAATGGGTG
GAAGACGTCACCAGCAAGTCCCTGCCTCCCATAGTCGAGCTTGAAGAGGCCCTCCGAGACGGAGTTACGCTGGCC
GAGATTGTCGAAGCCCTCAATCCCGACAAACGTTACCGGATATTCCACCACCCCAAGCTTCAATACCGCCACTCC
GACAACATCGCCATCTTCTTTCGTTATCTAGACGAGGTCGAGCTCCCTGACCTCTTCCGATTCGAGCTCATAGAC
CTCTACGAGAAGAAAAACATACCAAAGGTTATATACTGTATACACGCCCTGAGTTGGCTGCTGTTCCGCAAAGGC
ATCGTCGACTTCCGGATAGGCAACCTCGTCGGCCAGCTCGAGTTTGAACACCACGAGCTCGAGGCCATGCAAAAG
GGCCTCGATAAGCTGGGGGCCAACATGCCGAGCTTCGGTAACATGGGGGCCGACTTTGGCGTGCCTGAACCCGAG
CCCGAACCGCAAGAAACGGAAGAGGAGAGGATCGATCGGGAGTTGGGAGAGGTCAAGGAGTCCATCGTCGAATTG
CAGGCGCAAAGTCGAGGTTCCATACTGCGAATTCGCCTCGGCAACACGATGCAGCGCCTCTGGGACGGTGAGGAA
TGGCTGGTCGATCTGCAAGCACGTATTCGGGGTGACTTCACGCGTCAAATCATGCGCTACCGGCTCCAGATGCGA
CGGTCCGCGATCCTCGTCCAGAGTTCCGTGCGCGGATTTCTCGTCCGCCGAAGGCTGAGGCAGAACGACCAGTCC
TGCAAGGCCTCGGAACCGCTCGTCTTGGGCTTGCAAAGTGTGATACGCGCCAACAAAGTCCGCGGCGAGCTTCGC
GACCTCAGGTCCCTCTTGGAGGCGTGCAAGGGGCCTGTCCGGGAAATACAAGCGACTTCCCGAGGATTCCTGGCC
CGCAAGGACCACGCAGCGCAGCAGCGAGAGACACGGGCGACATCCGAGCCCGTCCGGAAACTCCAGGCCGCTGCC
CGCGGGTCGCTGTTGAGGGCACAAGTCGACGACCAGCTTCGACTCCTGGACGACCAAGCCGGTGCCGTTACTCAT
GCGCAGGCTGCTGCGAGGGGCTCGCAGACCAGAGCCCGGCTTGCTTGCGAACGCGACAATCTGCGGGCATTCGAA
TCGACGTGGACGGCGTTCCAGGCCTCGACTCGGGGAGCTGCCGCCCGAAGCCGCTATTCGGCGCTGAACGCGGAG
TTGGAGCAACAGGCGGGAGGCGTCGCCCAACTCCAGTCGTTGATGCGAGCCGCTATGGTACGGAGAGAGGTAACA
AGTCAACTGGACGAGTTAGAGTCGAACAGCGAAGACATGGTGGCTGTCCAATCCCATATTCGAGGCGTGCTGCAA
AGGAGGGACGTCTCTGCGCTCCGGCGACGCCTTGACCGCCACGTTGCTCCGACGGTCGACCTGCAGGCACACGGC
CGAGGACAGCTTGTCCGTCAACATCACGAAGCCCTAGTAGACGAGCTGCACTCTCACGACGACGCCATTGCGGCC
TTCCAGGCCATTCTCAAGGCCATGGTTGTGCGAGCACAAGTCGAGGACCTCGTCGCCGAGTTGCTAGAGGAAGAG
GACGCCATCGTTTCCGCCCAGGCCGCGGCCAAGGGCTTCCTCGTCCGCGCTCAGTTCGAGGAGAAGAAGCGGTAC
TTCAACGAGAACATGCAGAAAGTGGTCAAGATCCAGAGTTTCGTGCGTGCCAAGGTGCAGGGCGAAGCGTACAAG
AGCCTCACGACGGGCAAGAACCCGCCGGTCAACGCGGTCAAGAACTTTGTGCACCTGCTCAACGACAGCGACTTC
GACTTTAACGAGGAGGTCGAGTTTGAGAGGATACGGAAGACGGTGGTGCAGCAGGTGCGACAGAACGAGATGCTG
GAGCAGTACATTGACCAGCTCGACATCAAGATCGCCCTCCTGGTGAAGAACAAGATTACGCTCGACGAGGTTGTG
CGTCATCAGCACAACTACGGGGGCAGCTCGGTCGGGCTCCTGGCCAACTCGTCCATGTCCTCTGGCAACCAGTTC
GACCTGAAGGCTCTCAATAAAAGCTCGAGGAAGAAGCTTGAGTCGTACCAGCAGCTCTTCTTCAGCCTGCAGACG
CAGCCGCAATACCTGGCCCGGCTCTTCAAGCGCATGCGCGAGCAGGGGACGGCGGAGAAGGAGTGTAAGAGGATC
GAGCTTCTCATCATGAGTCTCTTTGGCTACGCGCAGAAGCGACGAGAGGAATACTACCTGCTGAAGCTGATTGCG
AGATCGATCCGGGAGGAGATTGAGGGCGCTGCCATGGTACACGAGTACGTCCGAGGCAACTACTTTTGGGCGAGG
CTGCTGGGCAACTACACGCGCTCGCCGAGAGACCGCAAATATCTGCGAAGCCTGCTGGGGCCGCTGATACGGGAC
AACTTCATCGAAGACCCGGCCCTGGACCTGGAAAGCGATCCGATGCAGATTTACCGGTCGGCCATCAACAACGAA
GAGCTGCGGACCGGACGGCCGGACCAACGGCCGCTGGATGTGCCTCGCGAGGTGGCCATCCGGGACCCCGAAACG
AGACGGCTCTTCATCGACCACCTGCGCGATCTCCGCGAGATCTGCGACCAGTTCTTTACGGCGCTCGAGGATCTG
CTGCACAAGATGCCCTACGGCCTCCGCTTCCTGTGCGGGCAGATGTTCGACACGCTCTGCCAGCACTTCAACAGG
GAGCCGCAGGGCCAGCTGCTGCAGGTTGTGGCCAATTGGCTGTGGAAGTTTTACCTCCAGCCGGCTCTGACGTCG
CCGGAGCAGGTGGGCGTGGTGGAGAAGACGCTGAGCCCGCTGCAAAAGAGGAACCTGGGCGAGGTGGCCAAGGTG
ATCGGGCAGGTGGCGTCAGGGCGGCCGTTTGGGGGCGACAACATCTACCTGCAGCCCCTGAACGCGTTTGTGACG
GAGTCGATGGAGCGGCTGCGGCTGATGATGAGGGAGCTGATGGCGGTGCCGGATGCGGAGCGGACATTCGACATT
GACGAGTTCAACGACCTCTACGCCAAGAACAAGCCGACGCTGTACATCAAGATGACGGACATCTTCGCCATCCAC
AACCTGGTGGCGGCAGAGCTGGCGGCCATGTGTCCGACGCGCGACGACGTGCTCGGCGAAATCATGAGCGACCTC
GGGAGCGCCAAGAGCAACGAGAACGAGATGAACGCGGCCGGGTCGTCGGACATTCACATGTTCCTGACGCCCAAG
CTCCACGACGTCGACGACCCCGAGGAGGACGTCAAGGCGCTGTTCATGGAGACGAAGCGCTGCGTGCTGTACATT
ATTCGCGTGCAGACGGGCGCCAACCTCCTGGAGATCTTGGTCAAGCCCATCACGGCGGAAGACGAGCAGCGGTGG
CGGGACCTGGTCCGCGACGACTTCTCCGACGACAGCGAGACGCGGGGCGCCTACTCGGACGCCAACATGGCGGAC
GTGACGCGGATGACGTACCATGAGCTGAAGCGGACGGCGCTGGAGAACGTGATGCGGCTGGAGCAGATGGGGCGC
ATCTCCAAGCACAACCTGTACCAGGACGTGCTCAACGCCATCGCCAGCGACATCCGGACCAAGAGCCGGCGGCGG
GTGCAGAGACAGAGGGAGCTCGAGGGCGTGCGGCTGACGCTGGGCAACCTGCACGAGAAGGCCAAGTACCTGGAG
CAGCAGCGGAGGAGCTACGACGACTACATTGAGCACGCCATGGCGACGCTGCAGAACAAGAAGGGGTAAGTGGCC
GGAGACTGTTGAGAGGGGGGGGGAAAGAGAGTGGAGAGAGGGAGAGAGAGAGAGAGAGAGGCCATGTGTGTGCTG
ACGAACTGGTTGTGATAGGAAGAAGCGATTCCTGCTGCCCTTTACCAAGCAGTACAACCACCAGCGCGAACTGGA
GCGCAGTGGGCGCGTGCCCAAGTTCGGCAGCTTCAAGTATAGCGCGCGGGCGCTGTCGGACAAGGGGGTGCTCGT
CTCTTGGAGCGGGCTCGGCGACCGCGACGTGGACAAGATCAACCTGACCATCTCGTGCGACGAGGTGGGCATCTT
TGCGCTCGAGGGGTCGCGTGGGCACATCCAGATGCCCGGGGCCAGCGCGCTGGTGTCCATCGAGGACCTGCTGCA
GGCGCAGTTTGAGTCGCACCAGTTTATGCACATCTTTGAGGGCAACTTGAAGCTCAACGTCAACTTGCTGCTGCA
TCTCATCTACAAGAAGTTTTACCGGACGGCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail