Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3516
Gene name
Locationscaffold_279:15371..16882
Strand-
Gene length (bp)1511
Transcript length (bp)1416
Coding sequence length (bp)1413
Protein length (aa) 471

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00141 peroxidase Peroxidase 7.1E-24 204 419

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q02567|PEM1_PHACH Manganese peroxidase 1 OS=Phanerochaete chrysosporium GN=MNP1 PE=1 SV=1 188 459 1.0E-31
sp|O94753|VPL2_PLEER Versatile peroxidase VPL2 OS=Pleurotus eryngii GN=vpl2 PE=1 SV=1 188 459 7.0E-31
sp|Q9UR19|VPL1_PLEER Versatile peroxidase VPL1 OS=Pleurotus eryngii GN=vpl1 PE=1 SV=1 188 459 1.0E-30
sp|P19136|PEM4_PHACH Manganese peroxidase H4 OS=Phanerochaete chrysosporium PE=1 SV=1 185 459 3.0E-29
sp|P11543|LIG5_PHACH Ligninase LG5 OS=Phanerochaete chrysosporium GN=GLG5 PE=2 SV=1 196 459 3.0E-28
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q02567|PEM1_PHACH Manganese peroxidase 1 OS=Phanerochaete chrysosporium GN=MNP1 PE=1 SV=1 188 459 1.0E-31
sp|O94753|VPL2_PLEER Versatile peroxidase VPL2 OS=Pleurotus eryngii GN=vpl2 PE=1 SV=1 188 459 7.0E-31
sp|Q9UR19|VPL1_PLEER Versatile peroxidase VPL1 OS=Pleurotus eryngii GN=vpl1 PE=1 SV=1 188 459 1.0E-30
sp|P19136|PEM4_PHACH Manganese peroxidase H4 OS=Phanerochaete chrysosporium PE=1 SV=1 185 459 3.0E-29
sp|P11543|LIG5_PHACH Ligninase LG5 OS=Phanerochaete chrysosporium GN=GLG5 PE=2 SV=1 196 459 3.0E-28
sp|Q70LM3|PEM2_PHLRA Manganese peroxidase 2 OS=Phlebia radiata GN=mnp2 PE=1 SV=1 196 459 7.0E-28
sp|P78733|PEM3_PHACH Manganese peroxidase H3 OS=Phanerochaete chrysosporium PE=1 SV=2 197 459 2.0E-27
sp|P28314|PER_COPCI Peroxidase OS=Coprinopsis cinerea GN=CIP1 PE=1 SV=2 197 459 2.0E-25
sp|Q96TS6|PEM3_PHLRA Manganese peroxidase 3 OS=Phlebia radiata GN=mnp3 PE=2 SV=1 164 460 2.0E-25
sp|P28313|PER_ARTRA Peroxidase OS=Arthromyces ramosus PE=1 SV=3 197 459 2.0E-25
sp|P49012|LIG2_PHACH Ligninase LG2 OS=Phanerochaete chrysosporium GN=GLG2 PE=1 SV=1 196 467 4.0E-25
sp|A8NK72|PER_COPC7 Peroxidase OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=CIP1 PE=3 SV=1 197 459 6.0E-25
sp|P06181|LIG8_PHACH Ligninase H8 OS=Phanerochaete chrysosporium GN=LPOA PE=1 SV=1 196 468 2.0E-24
sp|P31837|LIGA_PHACH Ligninase A OS=Phanerochaete chrysosporium GN=LIPA PE=3 SV=1 196 468 2.0E-23
sp|P31838|LIGB_PHACH Ligninase B OS=Phanerochaete chrysosporium GN=LIPB PE=3 SV=1 196 468 4.0E-23
sp|P20013|LIGC_TRAVE Ligninase C OS=Trametes versicolor PE=1 SV=2 197 459 8.0E-23
sp|P11542|LIG4_PHACH Ligninase H2 OS=Phanerochaete chrysosporium GN=GLG4 PE=1 SV=2 197 465 9.0E-22
sp|P50622|LIG6_PHACH Ligninase LG6 OS=Phanerochaete chrysosporium GN=GLG6 PE=2 SV=1 177 459 1.0E-21
sp|P20010|LIG_PHLRA Ligninase-3 OS=Phlebia radiata PE=3 SV=1 197 459 5.0E-21
sp|P21764|LIG3_PHACH Ligninase LG3 OS=Phanerochaete chrysosporium GN=GLG3 PE=2 SV=1 188 468 6.0E-21
sp|Q9UVP6|VPS1_PLEER Versatile peroxidase VPS1 OS=Pleurotus eryngii GN=vps1 PE=1 SV=1 193 459 3.0E-19
sp|C0IW58|LNP_TAICA Low-redox potential peroxidase OS=Taiwanofungus camphoratus GN=LnP PE=1 SV=1 197 459 1.0E-14
sp|Q8GY91|APX6_ARATH Putative L-ascorbate peroxidase 6 OS=Arabidopsis thaliana GN=APX6 PE=2 SV=1 199 434 2.0E-08
sp|Q7XZP5|APX5_ARATH L-ascorbate peroxidase 5, peroxisomal OS=Arabidopsis thaliana GN=APX5 PE=1 SV=2 226 446 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006979 response to oxidative stress Yes
GO:0004601 peroxidase activity Yes
GO:0020037 heme binding Yes
GO:0006950 response to stress No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No
GO:0016491 oxidoreductase activity No
GO:0050896 response to stimulus No
GO:0003824 catalytic activity No
GO:0008150 biological_process No
GO:0016684 oxidoreductase activity, acting on peroxide as acceptor No
GO:0003674 molecular_function No
GO:0046906 tetrapyrrole binding No
GO:0016209 antioxidant activity No
GO:1901363 heterocyclic compound binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.1135 0.0627 0.985 0.0936 0.0722 0.0199 0.0837 0.1116 0.1259 0.0031

SignalP

SignalP signal predicted Location Score
Yes 1 - 17 0.999887

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
AA2 1.7E-49 201 445

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup72
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7755
Ophiocordyceps australis map64 (Brazil) OphauB2|5788
Ophiocordyceps camponoti-floridani Ophcf2|03380
Ophiocordyceps camponoti-floridani Ophcf2|05952
Ophiocordyceps camponoti-floridani Ophcf2|06949
Ophiocordyceps camponoti-rufipedis Ophun1|2842
Ophiocordyceps camponoti-rufipedis Ophun1|490
Ophiocordyceps camponoti-rufipedis Ophun1|576
Ophiocordyceps kimflemingae Ophio5|1136
Ophiocordyceps kimflemingae Ophio5|3516 (this protein)
Ophiocordyceps kimflemingae Ophio5|4077
Ophiocordyceps kimflemingae Ophio5|6981
Ophiocordyceps subramaniannii Hirsu2|2648
Ophiocordyceps subramaniannii Hirsu2|7177
Ophiocordyceps subramaniannii Hirsu2|7933
Ophiocordyceps subramaniannii Hirsu2|9306

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3516
MKYSSVAVSILFGLSVACPGREVVSKTGLERRHILQQLQQQQQQLQRQQLEQQQQQQQQQQQQQQREGTKSQQRQ
GQQTGTRGQQGQQSQRGQGQQGQDQQIGQADQGQGQQGKSQPGQGGPPGGPPGGPPGGPLTKPPGPPGQVIGDLT
TLSDDQLTQTGRDIKQILKKDVFGDDNEATMGNVPPKDSSACAQDTCCIWKYVADEMKEAMTQQDGQCNDLARGA
IRLGFHDSMGFSRTNNSDAGADGSIVLANECETVDDNKGLRPTCDQMRTWFDQYKQYGVGMADLIQMGANVATVV
CPLGPRVRTFVGRKDSSTPAPNNSLPLFTDSVDHILTLMNDKTVSPFGLIALLGAHSTAHAPNVNAGTGDHPLDS
TPGVWDVAFYGEVLDANNTNNISKLESDLRLSQDSRTADVWKTFIGQKKGQLPWDKAYAAEYVRVSLLGVNNLNN
LTECTKVLPPFIPSFGNITTG
Coding >Ophio5|3516
ATGAAGTACAGCAGTGTTGCGGTGTCCATCCTGTTCGGACTTTCTGTCGCCTGTCCCGGTAGGGAGGTGGTGAGT
AAGACGGGGTTGGAAAGGCGGCATATTCTGCAGCAGCTTCAGCAGCAGCAGCAGCAACTTCAGCGGCAACAGCTG
GAGCAACAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCGGGAGGGAACCAAGAGCCAGCAGAGGCAA
GGCCAGCAGACGGGAACAAGAGGTCAACAAGGGCAGCAGAGCCAGCGAGGCCAGGGTCAGCAAGGGCAAGACCAG
CAGATTGGACAAGCCGATCAAGGACAAGGCCAGCAAGGGAAAAGTCAGCCAGGACAGGGCGGTCCTCCCGGCGGT
CCTCCCGGCGGTCCTCCCGGCGGCCCCCTTACCAAGCCTCCGGGCCCGCCGGGCCAAGTCATTGGCGATCTGACG
ACGCTCTCAGACGACCAGCTGACGCAGACGGGACGGGACATCAAGCAAATATTGAAAAAGGACGTCTTTGGCGAT
GACAACGAGGCGACCATGGGCAACGTGCCGCCCAAAGACTCGTCAGCGTGCGCCCAGGATACCTGCTGCATCTGG
AAGTACGTGGCCGACGAGATGAAGGAGGCCATGACACAACAAGACGGCCAATGCAACGACCTGGCCCGGGGAGCC
ATCCGTCTCGGCTTCCATGATTCCATGGGCTTCTCTAGGACGAACAATTCCGATGCCGGTGCCGACGGCTCCATC
GTCCTGGCCAACGAATGCGAGACGGTCGACGATAACAAGGGACTGCGTCCGACCTGTGACCAGATGCGTACCTGG
TTCGACCAGTATAAGCAGTATGGCGTCGGCATGGCCGATCTGATTCAGATGGGCGCCAATGTCGCCACCGTCGTC
TGTCCCCTCGGGCCTCGGGTCCGGACCTTTGTCGGCCGCAAGGACAGTTCGACGCCGGCTCCCAACAACAGCCTG
CCGCTCTTCACCGACAGCGTCGACCACATCCTCACCCTCATGAACGACAAGACGGTATCACCCTTTGGCCTCATC
GCTCTCCTCGGCGCGCACTCGACCGCCCACGCGCCCAACGTGAATGCCGGAACGGGCGACCATCCTCTCGATAGC
ACGCCGGGAGTATGGGACGTGGCCTTTTACGGCGAAGTCCTAGACGCCAACAACACGAATAACATCTCAAAGCTG
GAAAGCGACCTTCGCCTCAGCCAGGACTCGAGAACGGCTGACGTCTGGAAAACGTTTATAGGCCAGAAGAAGGGA
CAGCTTCCGTGGGACAAGGCTTATGCCGCTGAATATGTCCGCGTGAGCTTGCTCGGCGTCAATAACTTGAATAAC
CTCACCGAGTGTACAAAGGTTCTGCCACCCTTTATCCCGTCCTTTGGAAACATTACAACGGGG
Transcript >Ophio5|3516
ATGAAGTACAGCAGTGTTGCGGTGTCCATCCTGTTCGGACTTTCTGTCGCCTGTCCCGGTAGGGAGGTGGTGAGT
AAGACGGGGTTGGAAAGGCGGCATATTCTGCAGCAGCTTCAGCAGCAGCAGCAGCAACTTCAGCGGCAACAGCTG
GAGCAACAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCGGGAGGGAACCAAGAGCCAGCAGAGGCAA
GGCCAGCAGACGGGAACAAGAGGTCAACAAGGGCAGCAGAGCCAGCGAGGCCAGGGTCAGCAAGGGCAAGACCAG
CAGATTGGACAAGCCGATCAAGGACAAGGCCAGCAAGGGAAAAGTCAGCCAGGACAGGGCGGTCCTCCCGGCGGT
CCTCCCGGCGGTCCTCCCGGCGGCCCCCTTACCAAGCCTCCGGGCCCGCCGGGCCAAGTCATTGGCGATCTGACG
ACGCTCTCAGACGACCAGCTGACGCAGACGGGACGGGACATCAAGCAAATATTGAAAAAGGACGTCTTTGGCGAT
GACAACGAGGCGACCATGGGCAACGTGCCGCCCAAAGACTCGTCAGCGTGCGCCCAGGATACCTGCTGCATCTGG
AAGTACGTGGCCGACGAGATGAAGGAGGCCATGACACAACAAGACGGCCAATGCAACGACCTGGCCCGGGGAGCC
ATCCGTCTCGGCTTCCATGATTCCATGGGCTTCTCTAGGACGAACAATTCCGATGCCGGTGCCGACGGCTCCATC
GTCCTGGCCAACGAATGCGAGACGGTCGACGATAACAAGGGACTGCGTCCGACCTGTGACCAGATGCGTACCTGG
TTCGACCAGTATAAGCAGTATGGCGTCGGCATGGCCGATCTGATTCAGATGGGCGCCAATGTCGCCACCGTCGTC
TGTCCCCTCGGGCCTCGGGTCCGGACCTTTGTCGGCCGCAAGGACAGTTCGACGCCGGCTCCCAACAACAGCCTG
CCGCTCTTCACCGACAGCGTCGACCACATCCTCACCCTCATGAACGACAAGACGGTATCACCCTTTGGCCTCATC
GCTCTCCTCGGCGCGCACTCGACCGCCCACGCGCCCAACGTGAATGCCGGAACGGGCGACCATCCTCTCGATAGC
ACGCCGGGAGTATGGGACGTGGCCTTTTACGGCGAAGTCCTAGACGCCAACAACACGAATAACATCTCAAAGCTG
GAAAGCGACCTTCGCCTCAGCCAGGACTCGAGAACGGCTGACGTCTGGAAAACGTTTATAGGCCAGAAGAAGGGA
CAGCTTCCGTGGGACAAGGCTTATGCCGCTGAATATGTCCGCGTGAGCTTGCTCGGCGTCAATAACTTGAATAAC
CTCACCGAGTGTACAAAGGTTCTGCCACCCTTTATCCCGTCCTTTGGAAACATTACAACGGGGTGA
Gene >Ophio5|3516
ATGAAGTACAGCAGTGTTGCGGTGTCCATCCTGTTCGGACTTTCTGTCGCCTGTCCCGGTAGGGAGGTGGTGAGT
AAGACGGGGTTGGAAAGGCGGCATATTCTGCAGCAGCTTCAGCAGCAGCAGCAGCAACTTCAGCGGCAACAGCTG
GAGCAACAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCGGGAGGGAACCAAGAGCCAGCAGAGGCAA
GGCCAGCAGACGGGAACAAGAGGTCAACAAGGGCAGCAGAGCCAGCGAGGCCAGGGTCAGCAAGGGCAAGACCAG
CAGATTGGACAAGCCGATCAAGGACAAGGCCAGCAAGGGAAAAGTCAGCCAGGACAGGGCGGTCCTCCCGGCGGT
CCTCCCGGCGGTCCTCCCGGCGGCCCCCTTACCAAGCCTCCGGGCCCGCCGGGCCAAGTCATTGGCGATCTGACG
ACGCTCTCAGACGACCAGCTGACGCAGACGGGACGGGACATCAAGCAAATATTGAAAAAGGACGTCTTTGGCGAT
GACAACGAGGCGACCATGGGCAACGTGCCGCCCAAAGACTCGTCAGCGTGCGCCCAGGATACCTGCTGCATCTGG
AAGTACGTGGCCGACGAGATGAAGGAGGCCATGACACAACAAGACGGCCAATGCAACGACCTGGCCCGGGGAGCC
ATCCGTCTCGGCTTCCATGATTCCATGGGCTTCTCTAGGACGAACAATTCCGATGCCGGTGCCGACGGCTCCATC
GTCCTGGCCAACGAATGCGAGACGGTCGACGATAACAAGGGACTGCGTCCGACCTGTGACCAGATGCGTACCTGG
TTCGACCAGTATAAGCAGTATGGCGTCGGCATGGCCGATCTGATTCAGATGGGCGCCAATGTCGCCACCGTCGTC
TGTCCCCTCGGGCCTCGGGTCCGGACCTTTGTCGGCCGCAAGGACAGTTCGACGCCGGCTCCCAACAACAGCCTG
CCGCTCTTCACCGACAGCGTCGACCACATCCTCACCCTCATGAACGACAAGACGGTATCACCCTTTGGCCTCATC
GCTCTCCTCGGCGCGCACTCGACCGCCCACGCGCCCAACGTGAATGCCGGAACGGGCGACCATCCTCTCGATAGC
ACGCCGGGAGTATGGGACGTGGCCTTTTACGGCGAAGTCCTAGACGCCAACAACACGAATAACATCTCAAAGCTG
GAAAGCGACCTTCGCCTCAGCCAGGACTCGAGAACGGCTGACGTCTGGAAAACGTTTATAGGCCAGAAGAAGGGA
CAGCTTCCGTGGGACAAGGTAAGCAAATTTTTTTCCTCTCTCTCTCTCTCTCTCTTTTTGGACCGTCGTCTAGGG
AATTTTCGGCTGACGGTCGGGAATTTGCTTTTGACTAGGCTTATGCCGCTGAATATGTCCGCGTGAGCTTGCTCG
GCGTCAATAACTTGAATAACCTCACCGAGTGTACAAAGGTTCTGCCACCCTTTATCCCGTCCTTTGGAAACATTA
CAACGGGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail