Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3513
Gene name
Locationscaffold_279:8756..9503
Strand-
Gene length (bp)747
Transcript length (bp)747
Coding sequence length (bp)744
Protein length (aa) 248

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00782 DSPc Dual specificity phosphatase, catalytic domain 3.5E-09 96 186

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0008138 protein tyrosine/serine/threonine phosphatase activity Yes
GO:0016311 dephosphorylation Yes
GO:0004721 phosphoprotein phosphatase activity No
GO:0016791 phosphatase activity No
GO:0016787 hydrolase activity No
GO:0009987 cellular process No
GO:0140096 catalytic activity, acting on a protein No
GO:0006793 phosphorus metabolic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0003824 catalytic activity No
GO:0042578 phosphoric ester hydrolase activity No
GO:0003674 molecular_function No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0016788 hydrolase activity, acting on ester bonds No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3513
MYPSPLLILPLLLPLTTAIPPLKPPFPSFTTKLVKFFSASPPLRTCPPPGRPQSTAPFDAAGLHRFEWIVDRTIA
RSSAPFYRCRDGDQHMTPRTTAFLKRQGIKHVISLNEEARNPSIGETLQKAKIHYTPIPLSDYQSPSFADFNAAF
EAFRLQGSARTLVWCGYGHGRSGTFIVALLMYLEHHKPTPRVFRHLDYAKYHVETEAQAHVLDMLQAELKRRRLE
PSKTDKTKKWYKTARAPWARAVV
Coding >Ophio5|3513
ATGTATCCCTCCCCCCTCCTCATCCTCCCCCTCCTCCTCCCCCTTACAACCGCCATCCCCCCTCTAAAACCCCCC
TTCCCAAGCTTCACCACCAAACTCGTCAAATTCTTCTCCGCGAGCCCTCCCCTGCGAACCTGCCCCCCGCCCGGA
AGGCCTCAGAGCACAGCCCCCTTCGACGCCGCGGGCCTCCACCGCTTCGAATGGATCGTCGACAGGACCATCGCC
CGCTCCTCAGCCCCCTTTTATCGCTGCCGTGACGGGGACCAACACATGACGCCGCGGACCACGGCCTTCCTGAAG
CGCCAGGGTATCAAGCACGTCATCAGCCTCAACGAAGAGGCTCGCAACCCGTCGATTGGCGAGACGCTGCAAAAG
GCAAAGATTCATTATACGCCTATTCCCCTGTCCGATTATCAGTCGCCCTCGTTTGCAGACTTCAATGCCGCCTTT
GAAGCTTTTCGTCTTCAGGGCTCTGCTCGCACTTTGGTTTGGTGCGGTTATGGCCATGGACGCTCCGGCACCTTT
ATTGTCGCCTTGCTCATGTACTTGGAGCATCATAAGCCGACTCCTAGGGTTTTCCGCCACCTTGATTATGCCAAA
TATCACGTCGAGACGGAGGCGCAGGCTCATGTTTTGGACATGTTACAAGCCGAGCTGAAGCGGCGGAGGTTGGAA
CCTAGTAAGACGGACAAGACCAAGAAGTGGTATAAAACAGCCAGAGCACCTTGGGCGAGGGCCGTAGTT
Transcript >Ophio5|3513
ATGTATCCCTCCCCCCTCCTCATCCTCCCCCTCCTCCTCCCCCTTACAACCGCCATCCCCCCTCTAAAACCCCCC
TTCCCAAGCTTCACCACCAAACTCGTCAAATTCTTCTCCGCGAGCCCTCCCCTGCGAACCTGCCCCCCGCCCGGA
AGGCCTCAGAGCACAGCCCCCTTCGACGCCGCGGGCCTCCACCGCTTCGAATGGATCGTCGACAGGACCATCGCC
CGCTCCTCAGCCCCCTTTTATCGCTGCCGTGACGGGGACCAACACATGACGCCGCGGACCACGGCCTTCCTGAAG
CGCCAGGGTATCAAGCACGTCATCAGCCTCAACGAAGAGGCTCGCAACCCGTCGATTGGCGAGACGCTGCAAAAG
GCAAAGATTCATTATACGCCTATTCCCCTGTCCGATTATCAGTCGCCCTCGTTTGCAGACTTCAATGCCGCCTTT
GAAGCTTTTCGTCTTCAGGGCTCTGCTCGCACTTTGGTTTGGTGCGGTTATGGCCATGGACGCTCCGGCACCTTT
ATTGTCGCCTTGCTCATGTACTTGGAGCATCATAAGCCGACTCCTAGGGTTTTCCGCCACCTTGATTATGCCAAA
TATCACGTCGAGACGGAGGCGCAGGCTCATGTTTTGGACATGTTACAAGCCGAGCTGAAGCGGCGGAGGTTGGAA
CCTAGTAAGACGGACAAGACCAAGAAGTGGTATAAAACAGCCAGAGCACCTTGGGCGAGGGCCGTAGTTTAA
Gene >Ophio5|3513
ATGTATCCCTCCCCCCTCCTCATCCTCCCCCTCCTCCTCCCCCTTACAACCGCCATCCCCCCTCTAAAACCCCCC
TTCCCAAGCTTCACCACCAAACTCGTCAAATTCTTCTCCGCGAGCCCTCCCCTGCGAACCTGCCCCCCGCCCGGA
AGGCCTCAGAGCACAGCCCCCTTCGACGCCGCGGGCCTCCACCGCTTCGAATGGATCGTCGACAGGACCATCGCC
CGCTCCTCAGCCCCCTTTTATCGCTGCCGTGACGGGGACCAACACATGACGCCGCGGACCACGGCCTTCCTGAAG
CGCCAGGGTATCAAGCACGTCATCAGCCTCAACGAAGAGGCTCGCAACCCGTCGATTGGCGAGACGCTGCAAAAG
GCAAAGATTCATTATACGCCTATTCCCCTGTCCGATTATCAGTCGCCCTCGTTTGCAGACTTCAATGCCGCCTTT
GAAGCTTTTCGTCTTCAGGGCTCTGCTCGCACTTTGGTTTGGTGCGGTTATGGCCATGGACGCTCCGGCACCTTT
ATTGTCGCCTTGCTCATGTACTTGGAGCATCATAAGCCGACTCCTAGGGTTTTCCGCCACCTTGATTATGCCAAA
TATCACGTCGAGACGGAGGCGCAGGCTCATGTTTTGGACATGTTACAAGCCGAGCTGAAGCGGCGGAGGTTGGAA
CCTAGTAAGACGGACAAGACCAAGAAGTGGTATAAAACAGCCAGAGCACCTTGGGCGAGGGCCGTAGTTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail