Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3509
Gene name
Locationscaffold_279:701..1582
Strand+
Gene length (bp)881
Transcript length (bp)750
Coding sequence length (bp)747
Protein length (aa) 249

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 4.3E-15 21 161

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74852|YQ92_SCHPO Uncharacterized MFS-type transporter C18.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC18.02 PE=3 SV=1 20 165 1.0E-16
sp|Q91514|VACHT_TORTO Vesicular acetylcholine transporter OS=Torpedo torpedo PE=2 SV=1 20 178 2.0E-09
sp|P81721|VACHT_TORCA Vesicular acetylcholine transporter OS=Torpedo californica PE=2 SV=2 20 178 3.0E-09
sp|Q91498|VACHT_TORMA Vesicular acetylcholine transporter OS=Torpedo marmorata PE=2 SV=2 20 178 3.0E-09
sp|P34711|UNC17_CAEEL Vesicular acetylcholine transporter unc-17 OS=Caenorhabditis elegans GN=unc-17 PE=1 SV=1 20 146 9.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74852|YQ92_SCHPO Uncharacterized MFS-type transporter C18.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC18.02 PE=3 SV=1 20 165 1.0E-16
sp|Q91514|VACHT_TORTO Vesicular acetylcholine transporter OS=Torpedo torpedo PE=2 SV=1 20 178 2.0E-09
sp|P81721|VACHT_TORCA Vesicular acetylcholine transporter OS=Torpedo californica PE=2 SV=2 20 178 3.0E-09
sp|Q91498|VACHT_TORMA Vesicular acetylcholine transporter OS=Torpedo marmorata PE=2 SV=2 20 178 3.0E-09
sp|P34711|UNC17_CAEEL Vesicular acetylcholine transporter unc-17 OS=Caenorhabditis elegans GN=unc-17 PE=1 SV=1 20 146 9.0E-07
sp|Q16572|VACHT_HUMAN Vesicular acetylcholine transporter OS=Homo sapiens GN=SLC18A3 PE=2 SV=2 20 131 1.0E-06
sp|Q62666|VACHT_RAT Vesicular acetylcholine transporter OS=Rattus norvegicus GN=Slc18a3 PE=2 SV=2 20 131 3.0E-06
sp|O35304|VACHT_MOUSE Vesicular acetylcholine transporter OS=Mus musculus GN=Slc18a3 PE=2 SV=1 20 131 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.5

Transmembrane Domains

Domain # Start End Length
1 21 43 22
2 53 70 17
3 77 99 22
4 104 126 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3509
MDRSIPRGFRHRLAHIELQPFILCLAVLLASTLLFFLGTAPQLVVAARALQGASQAFVWVSGMALLASRVSKADN
LGLFSGYILMSGTIGELVGPLVGGPLYDAFGHWAVFAVIESILAVDVAMRLMVTAKRERGLKTGIEQASETDALL
RDGRHGDEADSDTTPSPTDTAIPSILGWNCLASIMAEAVAITIRCGLETVRFPHSSAKPKHDAYPIRQSLSSSST
ASPGPQQPAEASSSPSSSPPYSGP
Coding >Ophio5|3509
ATGGACCGCTCTATCCCTCGAGGCTTTCGGCATCGCCTCGCTCACATCGAGCTCCAACCTTTTATCCTCTGTCTC
GCTGTCCTTCTCGCTTCGACCCTCCTCTTCTTCCTCGGAACAGCGCCGCAGCTCGTCGTCGCTGCCCGCGCGCTA
CAAGGGGCTTCGCAGGCCTTTGTCTGGGTGTCCGGTATGGCTTTGCTGGCGTCGCGTGTCAGCAAGGCCGATAAT
CTAGGCCTCTTTTCGGGCTACATTCTGATGAGTGGCACGATTGGAGAGCTTGTTGGGCCGTTGGTGGGAGGGCCT
TTGTATGATGCTTTCGGTCATTGGGCTGTTTTTGCTGTCATCGAGAGCATACTCGCTGTTGATGTGGCAATGCGG
CTCATGGTAACTGCCAAGAGGGAAAGGGGCCTTAAGACGGGTATCGAACAGGCTTCCGAGACGGATGCTCTGCTC
CGGGATGGACGGCACGGAGACGAAGCTGATTCGGACACTACGCCGTCACCGACCGATACTGCGATTCCCAGCATT
CTAGGCTGGAACTGCCTGGCCAGCATCATGGCAGAAGCCGTCGCTATTACCATCCGCTGCGGTCTCGAAACCGTA
CGTTTCCCCCACTCCTCAGCGAAACCGAAACATGATGCTTATCCCATTAGACAATCCCTCTCGTCGTCCTCGACC
GCTTCGCCTGGTCCTCAACAGCCAGCGGAGGCGTCATCTTCGCCCTCCTCCTCCCCACCATACTCGGGCCCC
Transcript >Ophio5|3509
ATGGACCGCTCTATCCCTCGAGGCTTTCGGCATCGCCTCGCTCACATCGAGCTCCAACCTTTTATCCTCTGTCTC
GCTGTCCTTCTCGCTTCGACCCTCCTCTTCTTCCTCGGAACAGCGCCGCAGCTCGTCGTCGCTGCCCGCGCGCTA
CAAGGGGCTTCGCAGGCCTTTGTCTGGGTGTCCGGTATGGCTTTGCTGGCGTCGCGTGTCAGCAAGGCCGATAAT
CTAGGCCTCTTTTCGGGCTACATTCTGATGAGTGGCACGATTGGAGAGCTTGTTGGGCCGTTGGTGGGAGGGCCT
TTGTATGATGCTTTCGGTCATTGGGCTGTTTTTGCTGTCATCGAGAGCATACTCGCTGTTGATGTGGCAATGCGG
CTCATGGTAACTGCCAAGAGGGAAAGGGGCCTTAAGACGGGTATCGAACAGGCTTCCGAGACGGATGCTCTGCTC
CGGGATGGACGGCACGGAGACGAAGCTGATTCGGACACTACGCCGTCACCGACCGATACTGCGATTCCCAGCATT
CTAGGCTGGAACTGCCTGGCCAGCATCATGGCAGAAGCCGTCGCTATTACCATCCGCTGCGGTCTCGAAACCGTA
CGTTTCCCCCACTCCTCAGCGAAACCGAAACATGATGCTTATCCCATTAGACAATCCCTCTCGTCGTCCTCGACC
GCTTCGCCTGGTCCTCAACAGCCAGCGGAGGCGTCATCTTCGCCCTCCTCCTCCCCACCATACTCGGGCCCCTAA
Gene >Ophio5|3509
ATGGACCGCTCTATCCCTCGAGGCTTTCGGCATCGCCTCGCTCACATCGAGCTGTGAGAGGCGGGCAAAAGCACT
GCATCCCCCAAACCAATGCACAGCAGTTTGGCTGACCACCAGAAAACAAAACAACCACAATCACAGGGTTAGCAG
GCTACGTCACAGACGCCACCATCTTTTCCAAAAGCCAACCTTTTATCCTCTGTCTCGCTGTCCTTCTCGCTTCGA
CCCTCCTCTTCTTCCTCGGAACAGCGCCGCAGCTCGTCGTCGCTGCCCGCGCGCTACAAGGGGCTTCGCAGGCCT
TTGTCTGGGTGTCCGGTATGGCTTTGCTGGCGTCGCGTGTCAGCAAGGCCGATAATCTAGGCCTCTTTTCGGGCT
ACATTCTGATGAGTGGCACGATTGGAGAGCTTGTTGGGCCGTTGGTGGGAGGGCCTTTGTATGATGCTTTCGGTC
ATTGGGCTGTTTTTGCTGTCATCGAGAGCATACTCGCTGTTGATGTGGCAATGCGGCTCATGGTAACTGCCAAGA
GGGAAAGGGGCCTTAAGACGGGTATCGAACAGGCTTCCGAGACGGATGCTCTGCTCCGGGATGGACGGCACGGAG
ACGAAGCTGATTCGGACACTACGCCGTCACCGACCGATACTGCGATTCCCAGCATTCTAGGCTGGAACTGCCTGG
CCAGCATCATGGCAGAAGCCGTCGCTATTACCATCCGCTGCGGTCTCGAAACCGTACGTTTCCCCCACTCCTCAG
CGAAACCGAAACATGATGCTTATCCCATTAGACAATCCCTCTCGTCGTCCTCGACCGCTTCGCCTGGTCCTCAAC
AGCCAGCGGAGGCGTCATCTTCGCCCTCCTCCTCCCCACCATACTCGGGCCCCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail