Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3508
Gene name
Locationscaffold_278:24278..25360
Strand+
Gene length (bp)1082
Transcript length (bp)945
Coding sequence length (bp)942
Protein length (aa) 314

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05817 Ribophorin_II Oligosaccharyltransferase subunit Ribophorin II 1.0E-13 34 204
PF05817 Ribophorin_II Oligosaccharyltransferase subunit Ribophorin II 3.1E-06 236 305

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q02795|OSTD_YEAST Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit SWP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SWP1 PE=1 SV=1 13 302 2.0E-09
sp|O74943|YJB6_SCHPO Uncharacterized protein C553.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC553.06 PE=3 SV=1 10 202 1.0E-07

GO

GO Term Description Terminal node
GO:0006487 protein N-linked glycosylation Yes
GO:0016021 integral component of membrane Yes
GO:0008250 oligosaccharyltransferase complex Yes
GO:0043412 macromolecule modification No
GO:0043170 macromolecule metabolic process No
GO:0008150 biological_process No
GO:1901564 organonitrogen compound metabolic process No
GO:0032991 protein-containing complex No
GO:0006486 protein glycosylation No
GO:0044238 primary metabolic process No
GO:0031224 intrinsic component of membrane No
GO:0070085 glycosylation No
GO:1902494 catalytic complex No
GO:0043413 macromolecule glycosylation No
GO:0008152 metabolic process No
GO:1990234 transferase complex No
GO:0071704 organic substance metabolic process No
GO:0110165 cellular anatomical entity No
GO:0019538 protein metabolic process No
GO:0005575 cellular_component No
GO:0036211 protein modification process No
GO:0006807 nitrogen compound metabolic process No
GO:0140534 endoplasmic reticulum protein-containing complex No
GO:0098796 membrane protein complex No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

Domain # Start End Length
1 186 208 22
2 218 240 22
3 253 275 22
4 280 299 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3508
MRLLTASTVLLFVGAVSAASSWSFSDASVTGSSKAAKSVARKFSASEKASDAVLLGPKDSIKVSLTTLDDEAKAK
RPHQAFLLVRESSGLEVPFALTLKQSGKGTVQFSQKDLPKQLLHSPSPLQASLVLGSAGSTRGSITPTFDVELKL
DSASPAPSHHDPLRYGPLAEIDHTFRADPKSPPRIVSLAFALAVLASVPTLIVTVSLCHRETGDRDHVIPLSSIL
GARLTLVSAQWVLFGANLRHAATAFSRAPVSHAIFFGSVVGMECVFYLYHGGWNLFYTLPIVSLVGASAFLSGTK
ALGEVQRRRLAGER
Coding >Ophio5|3508
ATGCGTCTCCTAACAGCCTCGACGGTGCTCTTATTCGTGGGCGCAGTCAGCGCAGCTTCTTCCTGGAGTTTCTCT
GATGCATCCGTCACAGGCTCGTCCAAGGCGGCCAAGAGTGTGGCCAGAAAATTTTCCGCCTCTGAAAAGGCATCG
GATGCCGTGCTGTTGGGTCCAAAAGACTCGATCAAGGTGTCGCTAACGACGCTGGACGACGAAGCTAAAGCGAAG
CGACCGCACCAGGCTTTCCTCCTCGTCAGGGAATCGTCCGGCCTTGAGGTTCCGTTTGCCCTTACGCTGAAGCAG
TCCGGCAAAGGCACCGTTCAGTTTAGCCAGAAAGACCTCCCGAAGCAACTGCTTCATTCACCTTCACCTCTACAG
GCGAGTCTCGTCCTGGGCTCGGCCGGGTCGACGCGGGGCTCGATAACGCCAACGTTCGATGTCGAGCTGAAGCTG
GATTCTGCCAGCCCAGCGCCCAGCCACCATGACCCCCTGCGATACGGCCCACTGGCCGAGATCGACCACACATTC
CGGGCAGACCCCAAGAGTCCGCCACGAATTGTTTCTCTGGCCTTTGCCCTGGCTGTTTTGGCCAGCGTGCCGACT
CTTATCGTCACAGTGAGTCTTTGCCACCGTGAGACGGGCGACCGAGATCACGTGATCCCCCTGTCCTCCATCCTG
GGAGCCCGTTTGACGCTTGTGTCGGCGCAGTGGGTACTTTTCGGAGCCAACCTGAGGCACGCGGCCACAGCCTTT
TCCCGTGCTCCCGTGTCGCACGCCATCTTTTTCGGTTCCGTCGTCGGGATGGAATGTGTTTTTTACCTCTATCAT
GGTGGTTGGAACCTGTTCTACACGCTGCCGATTGTCAGCCTCGTCGGCGCTTCCGCCTTCCTGAGCGGGACCAAA
GCGCTTGGGGAGGTGCAGCGGCGGCGGCTAGCGGGCGAGAGG
Transcript >Ophio5|3508
ATGCGTCTCCTAACAGCCTCGACGGTGCTCTTATTCGTGGGCGCAGTCAGCGCAGCTTCTTCCTGGAGTTTCTCT
GATGCATCCGTCACAGGCTCGTCCAAGGCGGCCAAGAGTGTGGCCAGAAAATTTTCCGCCTCTGAAAAGGCATCG
GATGCCGTGCTGTTGGGTCCAAAAGACTCGATCAAGGTGTCGCTAACGACGCTGGACGACGAAGCTAAAGCGAAG
CGACCGCACCAGGCTTTCCTCCTCGTCAGGGAATCGTCCGGCCTTGAGGTTCCGTTTGCCCTTACGCTGAAGCAG
TCCGGCAAAGGCACCGTTCAGTTTAGCCAGAAAGACCTCCCGAAGCAACTGCTTCATTCACCTTCACCTCTACAG
GCGAGTCTCGTCCTGGGCTCGGCCGGGTCGACGCGGGGCTCGATAACGCCAACGTTCGATGTCGAGCTGAAGCTG
GATTCTGCCAGCCCAGCGCCCAGCCACCATGACCCCCTGCGATACGGCCCACTGGCCGAGATCGACCACACATTC
CGGGCAGACCCCAAGAGTCCGCCACGAATTGTTTCTCTGGCCTTTGCCCTGGCTGTTTTGGCCAGCGTGCCGACT
CTTATCGTCACAGTGAGTCTTTGCCACCGTGAGACGGGCGACCGAGATCACGTGATCCCCCTGTCCTCCATCCTG
GGAGCCCGTTTGACGCTTGTGTCGGCGCAGTGGGTACTTTTCGGAGCCAACCTGAGGCACGCGGCCACAGCCTTT
TCCCGTGCTCCCGTGTCGCACGCCATCTTTTTCGGTTCCGTCGTCGGGATGGAATGTGTTTTTTACCTCTATCAT
GGTGGTTGGAACCTGTTCTACACGCTGCCGATTGTCAGCCTCGTCGGCGCTTCCGCCTTCCTGAGCGGGACCAAA
GCGCTTGGGGAGGTGCAGCGGCGGCGGCTAGCGGGCGAGAGGTGA
Gene >Ophio5|3508
ATGCGTCTCCTAACAGCCTCGACGGTGCTCTTATTCGTGGGCGCAGTCAGCGCAGCTTCTTCCTGGAGTTTCTCT
GATGCATCCGTCACAGGCTCGTCCAAGGCGGCCAAGAGTGTGGCCAGAAAGTGAGTCTCCTCCGTTGGTGGTAGC
GTATCTCGTCTCGTCGGCTGACCTAGGGCATGACTGCAGATTTTCCGCCTCTGAAAAGGCATCGGATGCCGTGCT
GTTGGGTCCAAAAGACTCGATCAAGGTGTCGCTAACGACGCTGGACGACGAAGCTAAAGCGAAGCGACCGCACCA
GGCTTTCCTCCTCGTCAGGGAATCGTCCGGCCTTGAGGTTCCGTTTGCCCTTACGCTGAAGCAGTCCGGCAAAGG
CACCGTTCAGTTTGTATCGTCTCCCCCCCCCCCCCCCCCGTGACAGCTCATTCGACACCAGCTAACGTGAGGCCC
GGAACGGATAGAGCCAGAAAGACCTCCCGAAGCAACTGCTTCATTCACCTTCACCTCTACAGGCGAGTCTCGTCC
TGGGCTCGGCCGGGTCGACGCGGGGCTCGATAACGCCAACGTTCGATGTCGAGCTGAAGCTGGATTCTGCCAGCC
CAGCGCCCAGCCACCATGACCCCCTGCGATACGGCCCACTGGCCGAGATCGACCACACATTCCGGGCAGACCCCA
AGAGTCCGCCACGAATTGTTTCTCTGGCCTTTGCCCTGGCTGTTTTGGCCAGCGTGCCGACTCTTATCGTCACAG
TGAGTCTTTGCCACCGTGAGACGGGCGACCGAGATCACGTGATCCCCCTGTCCTCCATCCTGGGAGCCCGTTTGA
CGCTTGTGTCGGCGCAGTGGGTACTTTTCGGAGCCAACCTGAGGCACGCGGCCACAGCCTTTTCCCGTGCTCCCG
TGTCGCACGCCATCTTTTTCGGTTCCGTCGTCGGGATGGAATGTGTTTTTTACCTCTATCATGGTGGTTGGAACC
TGTTCTACACGCTGCCGATTGTCAGCCTCGTCGGCGCTTCCGCCTTCCTGAGCGGGACCAAAGCGCTTGGGGAGG
TGCAGCGGCGGCGGCTAGCGGGCGAGAGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail