Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3505
Gene name
Locationscaffold_278:19405..20737
Strand+
Gene length (bp)1332
Transcript length (bp)1245
Coding sequence length (bp)1242
Protein length (aa) 414

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16881 LIAS_N N-terminal domain of lipoyl synthase of Radical_SAM family 6.4E-18 32 128
PF04055 Radical_SAM Radical SAM superfamily 4.2E-11 152 314

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|B2AT43|LIPA_PODAN Lipoyl synthase, mitochondrial OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PODANS_1_14620 PE=3 SV=1 9 400 0.0E+00
sp|C7Z527|LIPA_NECH7 Lipoyl synthase, mitochondrial OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=NECHADRAFT_66689 PE=3 SV=1 2 412 0.0E+00
sp|Q7SF84|LIPA_NEUCR Lipoyl synthase, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU00565 PE=3 SV=1 9 393 0.0E+00
sp|D1Z4I6|LIPA_SORMK Lipoyl synthase, mitochondrial OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=SMAC_01256 PE=3 SV=1 9 393 0.0E+00
sp|A7EV21|LIPA_SCLS1 Lipoyl synthase, mitochondrial OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=SS1G_09179 PE=3 SV=1 17 409 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|B2AT43|LIPA_PODAN Lipoyl synthase, mitochondrial OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PODANS_1_14620 PE=3 SV=1 9 400 0.0E+00
sp|C7Z527|LIPA_NECH7 Lipoyl synthase, mitochondrial OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=NECHADRAFT_66689 PE=3 SV=1 2 412 0.0E+00
sp|Q7SF84|LIPA_NEUCR Lipoyl synthase, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU00565 PE=3 SV=1 9 393 0.0E+00
sp|D1Z4I6|LIPA_SORMK Lipoyl synthase, mitochondrial OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=SMAC_01256 PE=3 SV=1 9 393 0.0E+00
sp|A7EV21|LIPA_SCLS1 Lipoyl synthase, mitochondrial OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=SS1G_09179 PE=3 SV=1 17 409 0.0E+00
sp|A1CJC4|LIPA_ASPCL Lipoyl synthase, mitochondrial OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ACLA_034510 PE=3 SV=1 41 402 0.0E+00
sp|B8NUL8|LIPA_ASPFN Lipoyl synthase, mitochondrial OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=AFLA_100710 PE=3 SV=1 15 407 0.0E+00
sp|Q2U4H2|LIPA_ASPOR Lipoyl synthase, mitochondrial OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=AO090020000344 PE=3 SV=1 15 407 0.0E+00
sp|Q0V6U4|LIPA_PHANO Lipoyl synthase, mitochondrial OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SNOG_00270 PE=3 SV=2 53 398 0.0E+00
sp|Q5AQE4|LIPA_EMENI Lipoyl synthase, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN9486 PE=3 SV=1 30 402 0.0E+00
sp|B6HFQ1|LIPA_PENRW Lipoyl synthase, mitochondrial OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=Pc20g03200 PE=3 SV=1 17 389 0.0E+00
sp|C1H594|LIPA_PARBA Lipoyl synthase, mitochondrial OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=PAAG_05935 PE=3 SV=1 10 399 0.0E+00
sp|C5JVC1|LIPA_AJEDS Lipoyl synthase, mitochondrial OS=Ajellomyces dermatitidis (strain SLH14081) GN=BDBG_06713 PE=3 SV=1 11 401 0.0E+00
sp|C5GPL2|LIPA_AJEDR Lipoyl synthase, mitochondrial OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=BDCG_05907 PE=3 SV=1 11 401 0.0E+00
sp|A1D855|LIPA_NEOFI Lipoyl synthase, mitochondrial OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NFIA_070700 PE=3 SV=1 46 395 0.0E+00
sp|C0SDG9|LIPA_PARBP Lipoyl synthase, mitochondrial OS=Paracoccidioides brasiliensis (strain Pb03) GN=PABG_05724 PE=3 SV=1 2 386 0.0E+00
sp|Q4WWP1|LIPA_ASPFU Lipoyl synthase, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_3G06560 PE=3 SV=1 46 395 0.0E+00
sp|B0XYY2|LIPA_ASPFC Lipoyl synthase, mitochondrial OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=AFUB_042490 PE=3 SV=1 46 395 0.0E+00
sp|C6HLY2|LIPA_AJECH Lipoyl synthase, mitochondrial OS=Ajellomyces capsulatus (strain H143) GN=HCDG_07601 PE=3 SV=1 11 408 0.0E+00
sp|C0NXP6|LIPA_AJECG Lipoyl synthase, mitochondrial OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=HCBG_07690 PE=3 SV=1 11 408 0.0E+00
sp|C1GFM3|LIPA_PARBD Lipoyl synthase, mitochondrial OS=Paracoccidioides brasiliensis (strain Pb18) GN=PADG_06059 PE=3 SV=1 2 386 0.0E+00
sp|C5FZJ2|LIPA_ARTOC Lipoyl synthase, mitochondrial OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MCYG_08114 PE=3 SV=1 12 387 0.0E+00
sp|C5PIN8|LIPA_COCP7 Lipoyl synthase, mitochondrial OS=Coccidioides posadasii (strain C735) GN=CPC735_057610 PE=3 SV=1 3 409 0.0E+00
sp|C4JE77|LIPA_UNCRE Lipoyl synthase, mitochondrial OS=Uncinocarpus reesii (strain UAMH 1704) GN=UREG_00501 PE=3 SV=1 1 386 0.0E+00
sp|B2WBE8|LIPA_PYRTR Lipoyl synthase, mitochondrial OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=PTRG_06961 PE=3 SV=1 1 400 0.0E+00
sp|B6QSZ4|LIPA_TALMQ Lipoyl synthase, mitochondrial OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=PMAA_003450 PE=3 SV=1 1 396 2.0E-180
sp|A5ABM5|LIPA_ASPNC Lipoyl synthase, mitochondrial OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=An11g09760 PE=3 SV=1 39 389 7.0E-179
sp|B8MLU5|LIPA_TALSN Lipoyl synthase, mitochondrial OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=TSTA_101110 PE=3 SV=1 39 396 2.0E-173
sp|B6K4J2|LIPA_SCHJY Lipoyl synthase, mitochondrial OS=Schizosaccharomyces japonicus (strain yFS275 / FY16936) GN=SJAG_03553 PE=3 SV=1 54 393 6.0E-166
sp|A8N1T1|LIPA_COPC7 Lipoyl synthase, mitochondrial OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=CC1G_03624 PE=3 SV=1 92 390 6.0E-163
sp|B0CQH8|LIPA_LACBS Lipoyl synthase, mitochondrial OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=LACBIDRAFT_181332 PE=3 SV=1 92 395 3.0E-162
sp|Q6C6C6|LIPA_YARLI Lipoyl synthase, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0E10571g PE=3 SV=1 53 390 4.0E-161
sp|C5DY71|LIPA_ZYGRC Lipoyl synthase, mitochondrial OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=ZYRO0F10758g PE=3 SV=1 44 386 2.0E-160
sp|P32875|LIPA_YEAST Lipoyl synthase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LIP5 PE=1 SV=1 41 386 2.0E-158
sp|C8ZGV5|LIPA_YEAS8 Lipoyl synthase, mitochondrial OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=LIP5 PE=3 SV=1 41 386 2.0E-158
sp|A6ZP42|LIPA_YEAS7 Lipoyl synthase, mitochondrial OS=Saccharomyces cerevisiae (strain YJM789) GN=LIP5 PE=3 SV=1 41 386 2.0E-158
sp|B5VS81|LIPA_YEAS6 Lipoyl synthase, mitochondrial OS=Saccharomyces cerevisiae (strain AWRI1631) GN=LIP5 PE=3 SV=1 41 386 2.0E-158
sp|C7GWI3|LIPA_YEAS2 Lipoyl synthase, mitochondrial OS=Saccharomyces cerevisiae (strain JAY291) GN=LIP5 PE=3 SV=1 41 386 2.0E-158
sp|B3LJM6|LIPA_YEAS1 Lipoyl synthase, mitochondrial OS=Saccharomyces cerevisiae (strain RM11-1a) GN=LIP5 PE=3 SV=1 41 386 2.0E-158
sp|C5DGZ5|LIPA_LACTC Lipoyl synthase, mitochondrial OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=KLTH0D09548g PE=3 SV=1 4 389 6.0E-158
sp|Q6CLS2|LIPA_KLULA Lipoyl synthase, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=KLLA0F00836g PE=3 SV=1 28 387 3.0E-156
sp|O13642|LIPA_SCHPO Lipoyl synthase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lip5 PE=3 SV=2 53 392 3.0E-156
sp|A5DGI1|LIPA_PICGU Lipoyl synthase, mitochondrial OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PGUG_02382 PE=3 SV=2 39 398 9.0E-156
sp|B5RUV1|LIPA_DEBHA Lipoyl synthase, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DEHA2G18854g PE=3 SV=1 41 413 9.0E-156
sp|A3GGJ5|LIPA_PICST Lipoyl synthase, mitochondrial OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=PICST_86231 PE=3 SV=2 21 408 1.0E-155
sp|C5M276|LIPA_CANTT Lipoyl synthase, mitochondrial OS=Candida tropicalis (strain ATCC MYA-3404 / T1) GN=CTRG_00165 PE=3 SV=1 39 386 2.0E-155
sp|Q6FPY0|LIPA_CANGA Lipoyl synthase, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CAGL0I10923g PE=3 SV=1 37 386 8.0E-155
sp|B9WFS9|LIPA_CANDC Lipoyl synthase, mitochondrial OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=CD36_42180 PE=3 SV=1 10 386 2.0E-154
sp|P0CH68|LIPA_CANAW Lipoyl synthase, mitochondrial OS=Candida albicans (strain WO-1) GN=LAB5 PE=3 SV=1 9 386 2.0E-154
sp|P0CH67|LIPA_CANAL Lipoyl synthase, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=LAB5 PE=3 SV=1 9 386 2.0E-154
sp|A5E450|LIPA_LODEL Lipoyl synthase, mitochondrial OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=LELG_04389 PE=3 SV=1 41 386 8.0E-153
sp|C4QYF2|LIPA_PICPG Lipoyl synthase, mitochondrial OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=PAS_chr1-4_0425 PE=3 SV=1 50 386 2.0E-151
sp|P0CO58|LIPA_CRYNJ Lipoyl synthase, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CNL04340 PE=3 SV=1 75 386 3.0E-150
sp|P0CO59|LIPA_CRYNB Lipoyl synthase, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CNBI2500 PE=3 SV=1 75 386 3.0E-150
sp|C4YA37|LIPA_CLAL4 Lipoyl synthase, mitochondrial OS=Clavispora lusitaniae (strain ATCC 42720) GN=CLUG_04975 PE=3 SV=1 34 386 4.0E-150
sp|Q74ZH6|LIPA_ASHGO Lipoyl synthase, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=AGR231C PE=3 SV=1 36 386 9.0E-150
sp|B7FRU7|LIPA1_PHATC Lipoyl synthase 1, mitochondrial OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=PHATRDRAFT_18029 PE=3 SV=1 52 386 4.0E-144
sp|B0WAU6|LIAS_CULQU Lipoyl synthase, mitochondrial OS=Culex quinquefasciatus GN=CPIJ004250 PE=3 SV=1 92 386 1.0E-140
sp|B4IAA7|LIAS_DROSE Lipoyl synthase, mitochondrial OS=Drosophila sechellia GN=Las PE=3 SV=1 53 386 3.0E-140
sp|B4J3F3|LIAS_DROGR Lipoyl synthase, mitochondrial OS=Drosophila grimshawi GN=Las PE=3 SV=1 53 386 3.0E-140
sp|Q16W22|LIAS_AEDAE Lipoyl synthase, mitochondrial OS=Aedes aegypti GN=AAEL009368 PE=3 SV=1 92 387 5.0E-140
sp|Q7JQW6|LIAS_DROME Lipoyl synthase, mitochondrial OS=Drosophila melanogaster GN=Las PE=1 SV=2 53 386 6.0E-140
sp|Q6PHG4|LIAS_DANRE Lipoyl synthase, mitochondrial OS=Danio rerio GN=lias PE=2 SV=1 92 395 2.0E-139
sp|B4IUG3|LIAS1_DROYA Lipoyl synthase 1, mitochondrial OS=Drosophila yakuba GN=Las1 PE=3 SV=1 53 386 3.0E-139
sp|B4PF83|LIAS2_DROYA Lipoyl synthase 2, mitochondrial OS=Drosophila yakuba GN=Las2 PE=3 SV=1 53 386 3.0E-139
sp|B4KYY0|LIAS_DROMO Lipoyl synthase, mitochondrial OS=Drosophila mojavensis GN=Las PE=3 SV=1 53 386 6.0E-139
sp|Q6GQ48|LIAS_XENLA Lipoyl synthase, mitochondrial OS=Xenopus laevis GN=lias PE=2 SV=1 92 386 3.0E-138
sp|B3NIL9|LIAS_DROER Lipoyl synthase, mitochondrial OS=Drosophila erecta GN=Las PE=3 SV=1 53 386 4.0E-138
sp|Q2LYK1|LIAS_DROPS Lipoyl synthase, mitochondrial OS=Drosophila pseudoobscura pseudoobscura GN=Las PE=3 SV=1 53 391 6.0E-137
sp|B4MXR6|LIAS_DROWI Lipoyl synthase, mitochondrial OS=Drosophila willistoni GN=Las PE=3 SV=1 53 386 2.0E-136
sp|B3M996|LIAS_DROAN Lipoyl synthase, mitochondrial OS=Drosophila ananassae GN=Las PE=3 SV=1 53 386 1.0E-135
sp|C3Y3G4|LIAS_BRAFL Lipoyl synthase, mitochondrial OS=Branchiostoma floridae GN=BRAFLDRAFT_125969 PE=3 SV=1 92 386 1.0E-135
sp|Q5BIP7|LIAS_BOVIN Lipoyl synthase, mitochondrial OS=Bos taurus GN=LIAS PE=2 SV=1 92 386 8.0E-135
sp|Q5XIH4|LIAS_RAT Lipoyl synthase, mitochondrial OS=Rattus norvegicus GN=Lias PE=2 SV=1 92 386 1.0E-134
sp|Q99M04|LIAS_MOUSE Lipoyl synthase, mitochondrial OS=Mus musculus GN=Lias PE=1 SV=1 92 386 6.0E-134
sp|O43766|LIAS_HUMAN Lipoyl synthase, mitochondrial OS=Homo sapiens GN=LIAS PE=1 SV=3 92 386 6.0E-132
sp|Q21452|LIAS_CAEEL Lipoyl synthase, mitochondrial OS=Caenorhabditis elegans GN=M01F1.3 PE=3 SV=1 53 386 6.0E-131
sp|A8PF69|LIAS_BRUMA Lipoyl synthase, mitochondrial OS=Brugia malayi GN=Bm1_23910 PE=3 SV=1 53 389 2.0E-127
sp|C4PZQ3|LIAS_SCHMA Lipoyl synthase, mitochondrial OS=Schistosoma mansoni GN=Smp_010100 PE=3 SV=1 92 386 4.0E-127
sp|A8JGF7|LIAS_CHLRE Lipoyl synthase, mitochondrial OS=Chlamydomonas reinhardtii GN=LIP1 PE=3 SV=1 98 384 1.0E-125
sp|A4RZ86|LIAS_OSTLU Lipoyl synthase, mitochondrial OS=Ostreococcus lucimarinus (strain CCE9901) GN=LIP1 PE=3 SV=1 83 386 5.0E-124
sp|D0A0G6|LIPA_TRYB9 Lipoyl synthase, mitochondrial OS=Trypanosoma brucei gambiense (strain MHOM/CI/86/DAL972) GN=TbgDal_X18270 PE=3 SV=1 79 399 5.0E-123
sp|Q388A7|LIPA_TRYB2 Lipoyl synthase, mitochondrial OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=Tb10.61.1530 PE=3 SV=1 79 399 5.0E-123
sp|Q8IDQ0|LIPA_PLAF7 Lipoyl synthase, apicoplast OS=Plasmodium falciparum (isolate 3D7) GN=lipA PE=2 SV=1 76 392 6.0E-123
sp|Q7RBD6|LIPA_PLAYO Lipoyl synthase, apicoplast OS=Plasmodium yoelii yoelii GN=lipA PE=3 SV=1 72 394 1.0E-122
sp|D0NP70|LIPA_PHYIT Lipoyl synthase, mitochondrial OS=Phytophthora infestans (strain T30-4) GN=PITG_14852 PE=3 SV=1 83 386 6.0E-122
sp|B9RX57|LISC_RICCO Lipoyl synthase, chloroplastic OS=Ricinus communis GN=LIP1P PE=3 SV=1 45 387 1.0E-120
sp|B3SBB5|LIAS_TRIAD Lipoyl synthase, mitochondrial OS=Trichoplax adhaerens GN=TRIADDRAFT_38449 PE=3 SV=1 93 386 3.0E-120
sp|A9NNH7|LIAS_PICSI Lipoyl synthase, mitochondrial OS=Picea sitchensis GN=LIP1 PE=2 SV=1 94 387 6.0E-120
sp|Q4DYL7|LIPA2_TRYCC Lipoyl synthase 2, mitochondrial OS=Trypanosoma cruzi (strain CL Brener) GN=Tc00.1047053506211.10 PE=3 SV=1 36 386 3.0E-119
sp|A5CB81|LIAS_VITVI Lipoyl synthase, mitochondrial OS=Vitis vinifera GN=LIP1 PE=3 SV=1 50 383 4.0E-119
sp|B7FM45|LIAS_MEDTR Lipoyl synthase, mitochondrial OS=Medicago truncatula GN=LIP1 PE=2 SV=1 53 383 4.0E-118
sp|Q4DC43|LIPA1_TRYCC Lipoyl synthase 1, mitochondrial OS=Trypanosoma cruzi (strain CL Brener) GN=Tc00.1047053511291.30 PE=3 SV=1 32 386 5.0E-118
sp|Q3LSN4|LIAS1_PEA Lipoyl synthase 1, mitochondrial OS=Pisum sativum GN=LIP1-1 PE=2 SV=1 53 383 7.0E-117
sp|A2XU53|LIAS_ORYSI Lipoyl synthase, mitochondrial OS=Oryza sativa subsp. indica GN=LIP1 PE=3 SV=2 69 394 1.0E-116
sp|Q3LSN5|LIAS2_PEA Lipoyl synthase 2, mitochondrial OS=Pisum sativum GN=LIP1-2 PE=2 SV=1 53 383 1.0E-116
sp|B9H5L9|LIAS_POPTR Lipoyl synthase, mitochondrial OS=Populus trichocarpa GN=LIP1 PE=3 SV=1 30 383 2.0E-116
sp|B7G3Y9|LIPA2_PHATC Lipoyl synthase 2, mitochondrial OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=PHATRDRAFT_28652 PE=3 SV=1 83 386 2.0E-116
sp|C5Y9R0|LIAS_SORBI Lipoyl synthase, mitochondrial OS=Sorghum bicolor GN=LIP1 PE=3 SV=1 69 383 2.0E-116
sp|Q7XRF1|LIAS_ORYSJ Lipoyl synthase, mitochondrial OS=Oryza sativa subsp. japonica GN=LIP1 PE=2 SV=2 69 394 4.0E-116
sp|B8A031|LIAS_MAIZE Lipoyl synthase, mitochondrial OS=Zea mays GN=LIP1 PE=2 SV=1 69 389 2.0E-115
sp|Q9ZWT1|LIAS_ARATH Lipoyl synthase, mitochondrial OS=Arabidopsis thaliana GN=LIP1 PE=2 SV=1 96 383 1.0E-114
sp|B3L8F2|LIPA_PLAKH Lipoyl synthase, apicoplast OS=Plasmodium knowlesi (strain H) GN=lipA PE=3 SV=1 94 395 2.0E-114
sp|B8B016|LISC2_ORYSI Lipoyl synthase 2, chloroplastic OS=Oryza sativa subsp. indica GN=LIP1P-2 PE=3 SV=1 79 386 2.0E-114
sp|Q6L534|LISC2_ORYSJ Lipoyl synthase 2, chloroplastic OS=Oryza sativa subsp. japonica GN=LIP1P-2 PE=2 SV=1 79 386 4.0E-114
sp|A5K883|LIPA_PLAVS Lipoyl synthase, apicoplast OS=Plasmodium vivax (strain Salvador I) GN=lipA PE=3 SV=1 94 395 7.0E-114
sp|Q4QDI6|LIPA_LEIMA Lipoyl synthase, mitochondrial OS=Leishmania major GN=LmjF19.0350 PE=3 SV=1 12 386 4.0E-112
sp|B9I666|LISC1_POPTR Lipoyl synthase 1, chloroplastic OS=Populus trichocarpa GN=LIP1P-1 PE=3 SV=1 31 385 2.0E-111
sp|A4HY57|LIPA_LEIIN Lipoyl synthase, mitochondrial OS=Leishmania infantum GN=LinJ19.0190 PE=3 SV=1 34 390 4.0E-111
sp|B9N2B0|LISC2_POPTR Lipoyl synthase 2, chloroplastic OS=Populus trichocarpa GN=LIP1P-2 PE=3 SV=1 79 387 1.0E-110
sp|Q2IIW6|LIPA_ANADE Lipoyl synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=lipA PE=3 SV=2 94 386 2.0E-110
sp|A4RW69|LISC_OSTLU Lipoyl synthase, chloroplastic OS=Ostreococcus lucimarinus (strain CCE9901) GN=LIP1P PE=3 SV=1 94 387 4.0E-110
sp|C5XKZ1|LISC_SORBI Lipoyl synthase, chloroplastic OS=Sorghum bicolor GN=LIP1P PE=3 SV=1 79 393 2.0E-109
sp|Q8LEE8|LISC_ARATH Lipoyl synthase, chloroplastic OS=Arabidopsis thaliana GN=LIP1P PE=2 SV=2 49 385 2.0E-109
sp|A7HBU9|LIPA_ANADF Lipoyl synthase OS=Anaeromyxobacter sp. (strain Fw109-5) GN=lipA PE=3 SV=1 92 389 3.0E-109
sp|Q9HN78|LIPA_HALSA Probable lipoyl synthase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=lipA PE=3 SV=1 92 385 5.0E-109
sp|B0R7C4|LIPA_HALS3 Probable lipoyl synthase OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=lipA PE=3 SV=1 92 385 5.0E-109
sp|A8I2V9|LISC_CHLRE Lipoyl synthase, chloroplastic OS=Chlamydomonas reinhardtii GN=LIP1P PE=3 SV=1 2 400 2.0E-108
sp|B6TN12|LISC1_MAIZE Lipoyl synthase 1, chloroplastic OS=Zea mays GN=LIP1P-1 PE=2 SV=1 79 393 3.0E-108
sp|Q1D4N0|LIPA_MYXXD Lipoyl synthase OS=Myxococcus xanthus (strain DK 1622) GN=lipA PE=3 SV=2 91 385 7.0E-108
sp|Q3IU11|LIPA_NATPD Probable lipoyl synthase OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=lipA PE=3 SV=1 92 384 3.0E-107
sp|Q86G50|LIPA_TOXGO Lipoyl synthase, apicoplast OS=Toxoplasma gondii GN=lipA PE=2 SV=1 80 383 5.0E-107
sp|Q5ZAQ2|LISC1_ORYSJ Lipoyl synthase 1, chloroplastic OS=Oryza sativa subsp. japonica GN=LIP1P-1 PE=3 SV=1 82 385 2.0E-106
sp|B8AA76|LISC1_ORYSI Lipoyl synthase 1, chloroplastic OS=Oryza sativa subsp. indica GN=LIP1P-1 PE=3 SV=2 82 385 2.0E-106
sp|C0PN26|LISC2_MAIZE Lipoyl synthase 2, chloroplastic OS=Zea mays GN=LIP1P-2 PE=2 SV=1 79 385 4.0E-106
sp|B9LR22|LIPA_HALLT Probable lipoyl synthase OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=lipA PE=3 SV=1 92 385 3.0E-105
sp|A4H9Z3|LIPA_LEIBR Lipoyl synthase, mitochondrial OS=Leishmania braziliensis GN=LbrM19_V2.0670 PE=3 SV=1 34 390 1.0E-103
sp|Q5SLQ4|LIPA_THET8 Lipoyl synthase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=lipA PE=3 SV=1 94 384 2.0E-103
sp|Q72GV1|LIPA_THET2 Lipoyl synthase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=lipA PE=3 SV=1 94 384 2.0E-103
sp|A9FD62|LIPA_SORC5 Lipoyl synthase OS=Sorangium cellulosum (strain So ce56) GN=lipA PE=3 SV=1 94 398 5.0E-103
sp|Q1IXJ7|LIPA_DEIGD Lipoyl synthase OS=Deinococcus geothermalis (strain DSM 11300) GN=lipA PE=3 SV=1 94 381 9.0E-101
sp|B9RW49|LIAS_RICCO Lipoyl synthase, mitochondrial OS=Ricinus communis GN=LIP1 PE=3 SV=1 96 355 1.0E-100
sp|Q9RWA4|LIPA_DEIRA Lipoyl synthase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=lipA PE=3 SV=1 94 389 5.0E-100
sp|A1U380|LIPA_MARHV Lipoyl synthase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=lipA PE=3 SV=1 88 383 2.0E-99
sp|A1WT98|LIPA_HALHL Lipoyl synthase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=lipA PE=3 SV=1 92 381 1.0E-98
sp|Q67MF5|LIPA_SYMTH Lipoyl synthase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=lipA PE=3 SV=1 81 396 4.0E-98
sp|B0TZD6|LIPA_FRAP2 Lipoyl synthase OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=lipA PE=3 SV=1 92 383 2.0E-97
sp|Q5ZXI6|LIPA_LEGPH Lipoyl synthase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=lipA PE=3 SV=1 94 378 2.0E-97
sp|Q5X703|LIPA_LEGPA Lipoyl synthase OS=Legionella pneumophila (strain Paris) GN=lipA PE=3 SV=1 94 378 2.0E-97
sp|Q5WYF5|LIPA_LEGPL Lipoyl synthase OS=Legionella pneumophila (strain Lens) GN=lipA PE=3 SV=1 94 378 2.0E-97
sp|A5IGG3|LIPA_LEGPC Lipoyl synthase OS=Legionella pneumophila (strain Corby) GN=lipA PE=3 SV=1 94 378 6.0E-97
sp|Q0BM68|LIPA_FRATO Lipoyl synthase OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=lipA PE=3 SV=1 92 383 9.0E-97
sp|Q2A3R2|LIPA_FRATH Lipoyl synthase OS=Francisella tularensis subsp. holarctica (strain LVS) GN=lipA PE=3 SV=1 92 383 9.0E-97
sp|A7NBV0|LIPA_FRATF Lipoyl synthase OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=lipA PE=3 SV=1 92 383 9.0E-97
sp|A4IY90|LIPA_FRATW Lipoyl synthase OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=lipA PE=3 SV=1 92 383 1.0E-96
sp|Q5NH21|LIPA_FRATT Lipoyl synthase OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=lipA PE=3 SV=1 92 383 1.0E-96
sp|A0Q6Q2|LIPA_FRATN Lipoyl synthase OS=Francisella tularensis subsp. novicida (strain U112) GN=lipA PE=3 SV=1 92 383 1.0E-96
sp|Q14IH3|LIPA_FRAT1 Lipoyl synthase OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=lipA PE=3 SV=1 92 383 1.0E-96
sp|B2SH72|LIPA_FRATM Lipoyl synthase OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=lipA PE=3 SV=1 92 383 1.0E-96
sp|A4XYX3|LIPA_PSEMY Lipoyl synthase OS=Pseudomonas mendocina (strain ymp) GN=lipA PE=3 SV=1 94 383 3.0E-96
sp|Q9Y9E3|LIPA_AERPE Probable lipoyl synthase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=lipA PE=3 SV=2 106 389 1.0E-95
sp|Q0A8A4|LIPA_ALKEH Lipoyl synthase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=lipA PE=3 SV=1 79 381 3.0E-95
sp|A3MW09|LIPA_PYRCJ Probable lipoyl synthase OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=lipA PE=3 SV=1 93 388 2.0E-94
sp|Q97U63|LIPA_SULSO Probable lipoyl synthase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=lipA PE=3 SV=1 97 381 2.0E-92
sp|A4WK38|LIPA_PYRAR Probable lipoyl synthase OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=lipA PE=3 SV=1 90 378 3.0E-91
sp|Q4JBV4|LIPA_SULAC Probable lipoyl synthase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=lipA PE=3 SV=1 106 379 2.0E-90
sp|Q1AT13|LIPA_RUBXD Lipoyl synthase OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=lipA PE=3 SV=1 94 376 4.0E-90
sp|Q9K7C9|LIPA_BACHD Lipoyl synthase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=lipA PE=3 SV=1 85 387 4.0E-89
sp|Q8ERL8|LIPA_OCEIH Lipoyl synthase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=lipA PE=3 SV=1 87 376 2.0E-88
sp|Q1RGX4|LIPA_RICBR Lipoyl synthase OS=Rickettsia bellii (strain RML369-C) GN=lipA PE=3 SV=1 29 378 5.0E-88
sp|Q6L1L7|LIPA_PICTO Probable lipoyl synthase OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=lipA PE=3 SV=1 94 380 8.0E-88
sp|Q0W150|LIPA_METAR Probable lipoyl synthase OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=lipA PE=3 SV=1 94 386 2.0E-87
sp|Q5WDS6|LIPA_BACSK Lipoyl synthase OS=Bacillus clausii (strain KSM-K16) GN=lipA PE=3 SV=1 92 394 3.0E-87
sp|Q68W08|LIPA_RICTY Lipoyl synthase OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=lipA PE=3 SV=1 89 378 7.0E-87
sp|A8GUH3|LIPA_RICB8 Lipoyl synthase OS=Rickettsia bellii (strain OSU 85-389) GN=lipA PE=3 SV=2 90 378 1.0E-86
sp|Q8CPW4|LIPA_STAES Lipoyl synthase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=lipA PE=3 SV=1 86 390 2.0E-86
sp|Q5HQN7|LIPA_STAEQ Lipoyl synthase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=lipA PE=3 SV=1 86 390 2.0E-86
sp|Q49W64|LIPA_STAS1 Lipoyl synthase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=lipA PE=3 SV=1 90 380 2.0E-86
sp|Q2GKX7|LIPA_ANAPZ Lipoyl synthase OS=Anaplasma phagocytophilum (strain HZ) GN=lipA PE=3 SV=1 94 379 3.0E-86
sp|Q4L4T8|LIPA_STAHJ Lipoyl synthase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=lipA PE=3 SV=2 90 396 7.0E-86
sp|C5D7H5|LIPA_GEOSW Lipoyl synthase OS=Geobacillus sp. (strain WCH70) GN=lipA PE=3 SV=1 92 376 7.0E-86
sp|A8F2M4|LIPA_RICM5 Lipoyl synthase OS=Rickettsia massiliae (strain Mtu5) GN=lipA PE=3 SV=1 89 378 1.0E-85
sp|Q4UK97|LIPA_RICFE Lipoyl synthase OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=lipA PE=3 SV=2 89 378 1.0E-85
sp|Q2YWR5|LIPA_STAAB Lipoyl synthase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=lipA PE=3 SV=1 90 390 1.0E-85
sp|A8EZU2|LIPA_RICCK Lipoyl synthase OS=Rickettsia canadensis (strain McKiel) GN=lipA PE=3 SV=1 89 378 1.0E-85
sp|P65287|LIPA_STAAW Lipoyl synthase OS=Staphylococcus aureus (strain MW2) GN=lipA PE=3 SV=1 90 390 1.0E-85
sp|A8Z1I3|LIPA_STAAT Lipoyl synthase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=lipA PE=3 SV=1 90 390 1.0E-85
sp|Q6GB01|LIPA_STAAS Lipoyl synthase OS=Staphylococcus aureus (strain MSSA476) GN=lipA PE=3 SV=1 90 390 1.0E-85
sp|Q6GIG3|LIPA_STAAR Lipoyl synthase OS=Staphylococcus aureus (strain MRSA252) GN=lipA PE=3 SV=1 90 390 1.0E-85
sp|P65286|LIPA_STAAN Lipoyl synthase OS=Staphylococcus aureus (strain N315) GN=lipA PE=1 SV=1 90 390 1.0E-85
sp|P65285|LIPA_STAAM Lipoyl synthase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=lipA PE=3 SV=1 90 390 1.0E-85
sp|A6QFD6|LIPA_STAAE Lipoyl synthase OS=Staphylococcus aureus (strain Newman) GN=lipA PE=3 SV=1 90 390 1.0E-85
sp|Q5HHG0|LIPA_STAAC Lipoyl synthase OS=Staphylococcus aureus (strain COL) GN=lipA PE=3 SV=1 90 390 1.0E-85
sp|A5IRA1|LIPA_STAA9 Lipoyl synthase OS=Staphylococcus aureus (strain JH9) GN=lipA PE=3 SV=1 90 390 1.0E-85
sp|Q2FZX4|LIPA_STAA8 Lipoyl synthase OS=Staphylococcus aureus (strain NCTC 8325) GN=lipA PE=3 SV=1 90 390 1.0E-85
sp|Q2FIE9|LIPA_STAA3 Lipoyl synthase OS=Staphylococcus aureus (strain USA300) GN=lipA PE=3 SV=1 90 390 1.0E-85
sp|A6U030|LIPA_STAA2 Lipoyl synthase OS=Staphylococcus aureus (strain JH1) GN=lipA PE=3 SV=1 90 390 1.0E-85
sp|A7X0C7|LIPA_STAA1 Lipoyl synthase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=lipA PE=3 SV=1 90 390 1.0E-85
sp|O32129|LIPA_BACSU Lipoyl synthase OS=Bacillus subtilis (strain 168) GN=lipA PE=1 SV=2 92 387 2.0E-85
sp|Q5KVM7|LIPA_GEOKA Lipoyl synthase OS=Geobacillus kaustophilus (strain HTA426) GN=lipA PE=3 SV=2 91 380 2.0E-85
sp|B9EAJ9|LIPA_MACCJ Lipoyl synthase OS=Macrococcus caseolyticus (strain JCSC5402) GN=lipA PE=3 SV=1 90 393 2.0E-85
sp|A7Z8E8|LIPA_BACMF Lipoyl synthase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=lipA PE=3 SV=1 92 387 5.0E-85
sp|A7GUG3|LIPA_BACCN Lipoyl synthase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=lipA PE=3 SV=1 92 376 8.0E-85
sp|C4K1I0|LIPA_RICPU Lipoyl synthase OS=Rickettsia peacockii (strain Rustic) GN=lipA PE=3 SV=1 89 378 8.0E-85
sp|Q92GH8|LIPA_RICCN Lipoyl synthase OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=lipA PE=3 SV=2 89 378 1.0E-84
sp|A8GTI8|LIPA_RICRS Lipoyl synthase OS=Rickettsia rickettsii (strain Sheila Smith) GN=lipA PE=3 SV=1 89 378 1.0E-84
sp|B0BV26|LIPA_RICRO Lipoyl synthase OS=Rickettsia rickettsii (strain Iowa) GN=lipA PE=3 SV=1 89 378 1.0E-84
sp|C3PLL8|LIPA_RICAE Lipoyl synthase OS=Rickettsia africae (strain ESF-5) GN=lipA PE=3 SV=1 89 378 1.0E-84
sp|B9DIX8|LIPA_STACT Lipoyl synthase OS=Staphylococcus carnosus (strain TM300) GN=lipA PE=3 SV=1 90 380 1.0E-84
sp|O05959|LIPA_RICPR Lipoyl synthase OS=Rickettsia prowazekii (strain Madrid E) GN=lipA PE=3 SV=1 89 378 2.0E-84
sp|A4ISG5|LIPA_GEOTN Lipoyl synthase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=lipA PE=3 SV=1 92 380 3.0E-84
sp|A8GPR5|LIPA_RICAH Lipoyl synthase OS=Rickettsia akari (strain Hartford) GN=lipA PE=3 SV=1 89 378 3.0E-84
sp|B7IMZ7|LIPA_BACC2 Lipoyl synthase OS=Bacillus cereus (strain G9842) GN=lipA PE=3 SV=1 92 376 4.0E-84
sp|Q816A0|LIPA_BACCR Lipoyl synthase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=lipA PE=3 SV=1 92 376 2.0E-83
sp|B7HCZ6|LIPA_BACC4 Lipoyl synthase OS=Bacillus cereus (strain B4264) GN=lipA PE=3 SV=1 92 376 2.0E-83
sp|C1EY56|LIPA_BACC3 Lipoyl synthase OS=Bacillus cereus (strain 03BB102) GN=lipA PE=3 SV=1 92 376 2.0E-83
sp|A0RKF7|LIPA_BACAH Lipoyl synthase OS=Bacillus thuringiensis (strain Al Hakam) GN=lipA PE=3 SV=2 92 376 2.0E-83
sp|Q9A7I8|LIPA_CAUCR Lipoyl synthase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=lipA PE=3 SV=1 83 387 2.0E-83
sp|B8GW82|LIPA_CAUCN Lipoyl synthase OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=lipA PE=3 SV=1 83 387 2.0E-83
sp|Q631Z7|LIPA_BACCZ Lipoyl synthase OS=Bacillus cereus (strain ZK / E33L) GN=lipA PE=3 SV=1 92 376 2.0E-83
sp|B9J3H2|LIPA_BACCQ Lipoyl synthase OS=Bacillus cereus (strain Q1) GN=lipA PE=3 SV=1 92 376 2.0E-83
sp|B7HUW3|LIPA_BACC7 Lipoyl synthase OS=Bacillus cereus (strain AH187) GN=lipA PE=3 SV=1 92 376 2.0E-83
sp|Q72YB2|LIPA_BACC1 Lipoyl synthase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=lipA PE=3 SV=1 92 376 2.0E-83
sp|Q6HBT4|LIPA_BACHK Lipoyl synthase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=lipA PE=3 SV=1 92 376 3.0E-83
sp|B7JDM3|LIPA_BACC0 Lipoyl synthase OS=Bacillus cereus (strain AH820) GN=lipA PE=3 SV=1 92 376 3.0E-83
sp|Q81XM8|LIPA_BACAN Lipoyl synthase OS=Bacillus anthracis GN=lipA PE=3 SV=1 92 376 3.0E-83
sp|C3LCA6|LIPA_BACAC Lipoyl synthase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=lipA PE=3 SV=1 92 376 3.0E-83
sp|C3PDK2|LIPA_BACAA Lipoyl synthase OS=Bacillus anthracis (strain A0248) GN=lipA PE=3 SV=1 92 376 3.0E-83
sp|A8FH34|LIPA_BACP2 Lipoyl synthase OS=Bacillus pumilus (strain SAFR-032) GN=lipA PE=3 SV=1 92 387 3.0E-83
sp|A9VNX6|LIPA_BACWK Lipoyl synthase OS=Bacillus weihenstephanensis (strain KBAB4) GN=lipA PE=3 SV=1 92 376 4.0E-83
sp|Q2GGX7|LIPA_EHRCR Lipoyl synthase OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=lipA PE=3 SV=1 94 378 3.0E-82
sp|Q5PAD4|LIPA_ANAMM Lipoyl synthase OS=Anaplasma marginale (strain St. Maries) GN=lipA PE=3 SV=2 94 378 4.0E-82
sp|B9MQ24|LIPA_CALBD Lipoyl synthase OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=lipA PE=3 SV=1 94 382 4.0E-82
sp|Q0VN36|LIPA_ALCBS Lipoyl synthase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=lipA PE=3 SV=1 92 374 1.0E-81
sp|Q2NAD7|LIPA_ERYLH Lipoyl synthase OS=Erythrobacter litoralis (strain HTCC2594) GN=lipA PE=3 SV=1 82 380 1.0E-81
sp|B6IQ36|LIPA_RHOCS Lipoyl synthase OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=lipA PE=3 SV=1 90 378 2.0E-81
sp|A8GB09|LIPA_SERP5 Lipoyl synthase OS=Serratia proteamaculans (strain 568) GN=lipA PE=3 SV=1 87 374 2.0E-81
sp|Q89LR6|LIPA1_BRADU Lipoyl synthase 1 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=lipA1 PE=3 SV=1 94 378 5.0E-81
sp|B3CQP5|LIPA_ORITI Lipoyl synthase OS=Orientia tsutsugamushi (strain Ikeda) GN=lipA PE=3 SV=1 94 378 9.0E-81
sp|B4EV01|LIPA_PROMH Lipoyl synthase OS=Proteus mirabilis (strain HI4320) GN=lipA PE=3 SV=1 87 374 1.0E-80
sp|Q256D6|LIPA_CHLFF Lipoyl synthase OS=Chlamydophila felis (strain Fe/C-56) GN=lipA PE=3 SV=1 83 387 1.0E-80
sp|Q8ZUR9|LIPA_PYRAE Probable lipoyl synthase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=lipA PE=3 SV=1 93 380 1.0E-80
sp|A8I4L8|LIPA_AZOC5 Lipoyl synthase OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=lipA PE=3 SV=1 83 378 2.0E-80
sp|Q1GTM7|LIPA_SPHAL Lipoyl synthase OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=lipA PE=3 SV=1 92 378 2.0E-80
sp|Q5HB02|LIPA_EHRRW Lipoyl synthase OS=Ehrlichia ruminantium (strain Welgevonden) GN=lipA PE=3 SV=1 94 391 2.0E-80
sp|Q5FFK4|LIPA_EHRRG Lipoyl synthase OS=Ehrlichia ruminantium (strain Gardel) GN=lipA PE=3 SV=1 94 391 2.0E-80
sp|Q8R9E1|LIPA_CALS4 Lipoyl synthase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=lipA PE=3 SV=1 91 374 3.0E-80
sp|Q2GE84|LIPA_NEOSM Lipoyl synthase OS=Neorickettsia sennetsu (strain Miyayama) GN=lipA PE=3 SV=1 118 389 4.0E-80
sp|A5CCM4|LIPA_ORITB Lipoyl synthase OS=Orientia tsutsugamushi (strain Boryong) GN=lipA PE=3 SV=1 94 378 4.0E-80
sp|Q3YRT2|LIPA_EHRCJ Lipoyl synthase OS=Ehrlichia canis (strain Jake) GN=lipA PE=3 SV=1 94 378 7.0E-80
sp|A7IM78|LIPA_XANP2 Lipoyl synthase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=lipA PE=3 SV=1 90 378 9.0E-80
sp|Q5GSY2|LIPA_WOLTR Lipoyl synthase OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=lipA PE=3 SV=1 94 378 1.0E-79
sp|A1JPR9|LIPA_YERE8 Lipoyl synthase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=lipA PE=3 SV=1 87 374 2.0E-79
sp|Q9Z774|LIPA_CHLPN Lipoyl synthase OS=Chlamydia pneumoniae GN=lipA PE=3 SV=1 83 374 2.0E-79
sp|B1JGB7|LIPA_YERPY Lipoyl synthase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=lipA PE=3 SV=1 87 374 4.0E-79
sp|Q66DF5|LIPA_YERPS Lipoyl synthase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=lipA PE=3 SV=1 87 374 4.0E-79
sp|A4TP09|LIPA_YERPP Lipoyl synthase OS=Yersinia pestis (strain Pestoides F) GN=lipA PE=3 SV=1 87 374 4.0E-79
sp|Q1CKR6|LIPA_YERPN Lipoyl synthase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=lipA PE=3 SV=1 87 374 4.0E-79
sp|A9R703|LIPA_YERPG Lipoyl synthase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=lipA PE=3 SV=1 87 374 4.0E-79
sp|Q8ZDH0|LIPA_YERPE Lipoyl synthase OS=Yersinia pestis GN=lipA PE=3 SV=1 87 374 4.0E-79
sp|B2K874|LIPA_YERPB Lipoyl synthase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=lipA PE=3 SV=1 87 374 4.0E-79
sp|Q1C507|LIPA_YERPA Lipoyl synthase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=lipA PE=3 SV=1 87 374 4.0E-79
sp|A7FKY9|LIPA_YERP3 Lipoyl synthase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=lipA PE=3 SV=1 87 374 4.0E-79
sp|C5BGD9|LIPA_EDWI9 Lipoyl synthase OS=Edwardsiella ictaluri (strain 93-146) GN=lipA PE=3 SV=1 87 374 5.0E-79
sp|Q2G712|LIPA_NOVAD Lipoyl synthase OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=lipA PE=3 SV=1 92 378 5.0E-79
sp|A4XHV2|LIPA_CALS8 Lipoyl synthase OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=lipA PE=3 SV=1 91 376 5.0E-79
sp|A6T689|LIPA_KLEP7 Lipoyl synthase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=lipA PE=3 SV=1 87 374 1.0E-78
sp|B5XZS6|LIPA_KLEP3 Lipoyl synthase OS=Klebsiella pneumoniae (strain 342) GN=lipA PE=3 SV=1 87 374 1.0E-78
sp|A6LE09|LIPA_PARD8 Lipoyl synthase OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=lipA PE=3 SV=1 92 374 2.0E-78
sp|C1D5T3|LIPA_LARHH Lipoyl synthase OS=Laribacter hongkongensis (strain HLHK9) GN=lipA PE=3 SV=1 92 376 2.0E-78
sp|B2VBK1|LIPA_ERWT9 Lipoyl synthase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=lipA PE=3 SV=1 87 374 2.0E-78
sp|A7MNP9|LIPA_CROS8 Lipoyl synthase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=lipA PE=3 SV=1 87 374 2.0E-78
sp|Q2RHM6|LIPA_MOOTA Lipoyl synthase OS=Moorella thermoacetica (strain ATCC 39073) GN=lipA PE=3 SV=1 92 376 2.0E-78
sp|Q0BSW6|LIPA_GRABC Lipoyl synthase OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=lipA PE=3 SV=2 94 378 2.0E-78
sp|Q57390|LIPA_PELCD Lipoyl synthase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=lipA PE=3 SV=2 94 374 3.0E-78
sp|A4SEG3|LIPA_CHLPM Lipoyl synthase OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=lipA PE=3 SV=1 92 375 3.0E-78
sp|A7HXW0|LIPA_PARL1 Lipoyl synthase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=lipA PE=3 SV=1 90 378 3.0E-78
sp|Q7NTF9|LIPA_CHRVO Lipoyl synthase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=lipA PE=3 SV=1 94 374 4.0E-78
sp|A4YUR5|LIPA_BRASO Lipoyl synthase OS=Bradyrhizobium sp. (strain ORS278) GN=lipA PE=3 SV=1 94 378 5.0E-78
sp|B9KSE2|LIPA_RHOSK Lipoyl synthase OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=lipA PE=3 SV=1 94 388 6.0E-78
sp|Q3J2P4|LIPA_RHOS4 Lipoyl synthase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=lipA PE=3 SV=1 94 388 6.0E-78
sp|A3PJL9|LIPA_RHOS1 Lipoyl synthase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=lipA PE=3 SV=1 94 388 6.0E-78
sp|A4WRC8|LIPA_RHOS5 Lipoyl synthase OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=lipA PE=3 SV=1 92 378 7.0E-78
sp|Q6D7M8|LIPA_PECAS Lipoyl synthase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=lipA PE=3 SV=1 87 374 7.0E-78
sp|A1B1T3|LIPA_PARDP Lipoyl synthase OS=Paracoccus denitrificans (strain Pd 1222) GN=lipA PE=3 SV=1 94 380 8.0E-78
sp|Q1II13|LIPA_KORVE Lipoyl synthase OS=Koribacter versatilis (strain Ellin345) GN=lipA PE=3 SV=1 94 376 8.0E-78
sp|C6DBV6|LIPA_PECCP Lipoyl synthase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=lipA PE=3 SV=1 87 374 1.0E-77
sp|Q1GGW2|LIPA_RUEST Lipoyl synthase OS=Ruegeria sp. (strain TM1040) GN=lipA PE=3 SV=2 94 378 2.0E-77
sp|Q7VKB1|LIPA_HAEDU Lipoyl synthase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=lipA PE=3 SV=1 88 374 2.0E-77
sp|C3K2L8|LIPA_PSEFS Lipoyl synthase OS=Pseudomonas fluorescens (strain SBW25) GN=lipA PE=3 SV=1 90 376 2.0E-77
sp|B0BA11|LIPA_CHLTB Lipoyl synthase OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=lipA PE=3 SV=1 83 396 2.0E-77
sp|B0B8D2|LIPA_CHLT2 Lipoyl synthase OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=lipA PE=3 SV=1 83 396 2.0E-77
sp|B2IB58|LIPA_BEII9 Lipoyl synthase OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=lipA PE=3 SV=1 61 378 2.0E-77
sp|Q3KLD9|LIPA_CHLTA Lipoyl synthase OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=lipA PE=3 SV=1 83 396 3.0E-77
sp|A9MKE4|LIPA_SALAR Lipoyl synthase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=lipA PE=3 SV=1 87 374 3.0E-77
sp|Q3SM23|LIPA_THIDA Lipoyl synthase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=lipA PE=3 SV=1 54 372 3.0E-77
sp|A5CWR6|LIPA_VESOH Lipoyl synthase OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=lipA PE=3 SV=1 88 375 3.0E-77
sp|A4W814|LIPA_ENT38 Lipoyl synthase OS=Enterobacter sp. (strain 638) GN=lipA PE=3 SV=1 87 374 3.0E-77
sp|Q8ZR04|LIPA_SALTY Lipoyl synthase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=lipA PE=3 SV=1 87 374 4.0E-77
sp|B4TPA3|LIPA_SALSV Lipoyl synthase OS=Salmonella schwarzengrund (strain CVM19633) GN=lipA PE=3 SV=1 87 374 4.0E-77
sp|B5BCG1|LIPA_SALPK Lipoyl synthase OS=Salmonella paratyphi A (strain AKU_12601) GN=lipA PE=3 SV=1 87 374 4.0E-77
sp|C0PW62|LIPA_SALPC Lipoyl synthase OS=Salmonella paratyphi C (strain RKS4594) GN=lipA PE=3 SV=1 87 374 4.0E-77
sp|A9MV74|LIPA_SALPB Lipoyl synthase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=lipA PE=3 SV=1 87 374 4.0E-77
sp|Q5PM97|LIPA_SALPA Lipoyl synthase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=lipA PE=3 SV=1 87 374 4.0E-77
sp|B4SYJ0|LIPA_SALNS Lipoyl synthase OS=Salmonella newport (strain SL254) GN=lipA PE=3 SV=1 87 374 4.0E-77
sp|B4TAI5|LIPA_SALHS Lipoyl synthase OS=Salmonella heidelberg (strain SL476) GN=lipA PE=3 SV=1 87 374 4.0E-77
sp|B5R7Y1|LIPA_SALG2 Lipoyl synthase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=lipA PE=3 SV=1 87 374 4.0E-77
sp|B5QVN4|LIPA_SALEP Lipoyl synthase OS=Salmonella enteritidis PT4 (strain P125109) GN=lipA PE=3 SV=1 87 374 4.0E-77
sp|B5FMM8|LIPA_SALDC Lipoyl synthase OS=Salmonella dublin (strain CT_02021853) GN=lipA PE=3 SV=1 87 374 4.0E-77
sp|Q57RU3|LIPA_SALCH Lipoyl synthase OS=Salmonella choleraesuis (strain SC-B67) GN=lipA PE=3 SV=1 87 374 4.0E-77
sp|B5EZ72|LIPA_SALA4 Lipoyl synthase OS=Salmonella agona (strain SL483) GN=lipA PE=3 SV=1 87 374 4.0E-77
sp|P61200|LIPA_WOLPM Lipoyl synthase OS=Wolbachia pipientis wMel GN=lipA PE=3 SV=1 94 378 4.0E-77
sp|B3CP16|LIPA_WOLPP Lipoyl synthase OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=lipA PE=3 SV=1 94 393 4.0E-77
sp|B4RBV1|LIPA_PHEZH Lipoyl synthase OS=Phenylobacterium zucineum (strain HLK1) GN=lipA PE=3 SV=1 90 378 5.0E-77
sp|C0R2Q4|LIPA_WOLWR Lipoyl synthase OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=lipA PE=3 SV=1 94 378 6.0E-77
sp|Q8KDH2|LIPA_CHLTE Lipoyl synthase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=lipA PE=3 SV=1 94 378 6.0E-77
sp|P61199|LIPA_TREDE Lipoyl synthase OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=lipA PE=3 SV=1 92 374 7.0E-77
sp|B7LLI3|LIPA_ESCF3 Lipoyl synthase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=lipA PE=3 SV=1 87 374 7.0E-77
sp|Q2NUV8|LIPA_SODGM Lipoyl synthase OS=Sodalis glossinidius (strain morsitans) GN=lipA PE=3 SV=1 87 374 8.0E-77
sp|Q5LGU6|LIPA_BACFN Lipoyl synthase OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=lipA PE=3 SV=1 92 374 8.0E-77
sp|Q8Z8I3|LIPA_SALTI Lipoyl synthase OS=Salmonella typhi GN=lipA PE=3 SV=1 87 374 9.0E-77
sp|Q64XQ0|LIPA_BACFR Lipoyl synthase OS=Bacteroides fragilis (strain YCH46) GN=lipA PE=3 SV=1 92 374 1.0E-76
sp|B3QNE9|LIPA_CHLP8 Lipoyl synthase OS=Chlorobaculum parvum (strain NCIB 8327) GN=lipA PE=3 SV=1 94 378 1.0E-76
sp|A5EIM5|LIPA_BRASB Lipoyl synthase OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=lipA PE=3 SV=1 94 378 1.0E-76
sp|A4VQZ6|LIPA_PSEU5 Lipoyl synthase OS=Pseudomonas stutzeri (strain A1501) GN=lipA PE=3 SV=1 90 376 1.0E-76
sp|O84562|LIPA_CHLTR Lipoyl synthase OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=lipA PE=3 SV=1 83 396 2.0E-76
sp|Q07MZ5|LIPA_RHOP5 Lipoyl synthase OS=Rhodopseudomonas palustris (strain BisA53) GN=lipA PE=3 SV=1 94 378 2.0E-76
sp|A5EVQ3|LIPA_DICNV Lipoyl synthase OS=Dichelobacter nodosus (strain VCS1703A) GN=lipA PE=3 SV=1 94 374 2.0E-76
sp|A8AJH6|LIPA_CITK8 Lipoyl synthase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=lipA PE=3 SV=1 87 374 2.0E-76
sp|Q3K6A4|LIPA_PSEPF Lipoyl synthase OS=Pseudomonas fluorescens (strain Pf0-1) GN=lipA PE=3 SV=1 90 376 3.0E-76
sp|Q087L5|LIPA_SHEFN Lipoyl synthase OS=Shewanella frigidimarina (strain NCIMB 400) GN=lipA PE=3 SV=1 87 374 4.0E-76
sp|B8G782|LIPA_CHLAD Lipoyl synthase OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=lipA PE=3 SV=1 81 374 4.0E-76
sp|Q7MN17|LIPA_VIBVY Lipoyl synthase OS=Vibrio vulnificus (strain YJ016) GN=lipA PE=3 SV=1 87 374 5.0E-76
sp|Q8DFD1|LIPA_VIBVU Lipoyl synthase OS=Vibrio vulnificus (strain CMCP6) GN=lipA PE=3 SV=1 87 374 5.0E-76
sp|Q2SA38|LIPA_HAHCH Lipoyl synthase OS=Hahella chejuensis (strain KCTC 2396) GN=lipA PE=3 SV=1 90 393 5.0E-76
sp|Q6LN87|LIPA_PHOPR Lipoyl synthase OS=Photobacterium profundum GN=lipA PE=3 SV=1 88 374 5.0E-76
sp|Q3IJ81|LIPA_PSEHT Lipoyl synthase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=lipA PE=3 SV=1 87 376 5.0E-76
sp|Q8YXD1|LIPA2_NOSS1 Lipoyl synthase 2 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=lipA2 PE=3 SV=1 90 376 6.0E-76
sp|Q3Z4G4|LIPA_SHISS Lipoyl synthase OS=Shigella sonnei (strain Ss046) GN=lipA PE=3 SV=1 87 374 6.0E-76
sp|P60719|LIPA_SHIFL Lipoyl synthase OS=Shigella flexneri GN=lipA PE=3 SV=1 87 374 6.0E-76
sp|Q0T6N8|LIPA_SHIF8 Lipoyl synthase OS=Shigella flexneri serotype 5b (strain 8401) GN=lipA PE=3 SV=2 87 374 6.0E-76
sp|Q32IV2|LIPA_SHIDS Lipoyl synthase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=lipA PE=3 SV=1 87 374 6.0E-76
sp|Q324R5|LIPA_SHIBS Lipoyl synthase OS=Shigella boydii serotype 4 (strain Sb227) GN=lipA PE=3 SV=1 87 374 6.0E-76
sp|Q1RET3|LIPA_ECOUT Lipoyl synthase OS=Escherichia coli (strain UTI89 / UPEC) GN=lipA PE=3 SV=1 87 374 6.0E-76
sp|B1LKL9|LIPA_ECOSM Lipoyl synthase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=lipA PE=3 SV=1 87 374 6.0E-76
sp|B6I137|LIPA_ECOSE Lipoyl synthase OS=Escherichia coli (strain SE11) GN=lipA PE=3 SV=1 87 374 6.0E-76
sp|B7N9N3|LIPA_ECOLU Lipoyl synthase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=lipA PE=3 SV=1 87 374 6.0E-76
sp|P60716|LIPA_ECOLI Lipoyl synthase OS=Escherichia coli (strain K12) GN=lipA PE=1 SV=1 87 374 6.0E-76
sp|B1IYI0|LIPA_ECOLC Lipoyl synthase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=lipA PE=3 SV=1 87 374 6.0E-76
sp|P60717|LIPA_ECOL6 Lipoyl synthase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=lipA PE=3 SV=1 87 374 6.0E-76
sp|Q0TK45|LIPA_ECOL5 Lipoyl synthase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=lipA PE=3 SV=1 87 374 6.0E-76
sp|A1A8Q3|LIPA_ECOK1 Lipoyl synthase OS=Escherichia coli O1:K1 / APEC GN=lipA PE=3 SV=1 87 374 6.0E-76
sp|A7ZXQ4|LIPA_ECOHS Lipoyl synthase OS=Escherichia coli O9:H4 (strain HS) GN=lipA PE=3 SV=1 87 374 6.0E-76
sp|C4ZWB5|LIPA_ECOBW Lipoyl synthase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=lipA PE=3 SV=1 87 374 6.0E-76
sp|B7M5F5|LIPA_ECO8A Lipoyl synthase OS=Escherichia coli O8 (strain IAI1) GN=lipA PE=3 SV=1 87 374 6.0E-76
sp|B7MRR5|LIPA_ECO81 Lipoyl synthase OS=Escherichia coli O81 (strain ED1a) GN=lipA PE=3 SV=1 87 374 6.0E-76
sp|B7NLY7|LIPA_ECO7I Lipoyl synthase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=lipA PE=3 SV=1 87 374 6.0E-76
sp|B5YQH9|LIPA_ECO5E Lipoyl synthase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=lipA PE=3 SV=1 87 374 6.0E-76
sp|P60718|LIPA_ECO57 Lipoyl synthase OS=Escherichia coli O157:H7 GN=lipA PE=3 SV=1 87 374 6.0E-76
sp|B7L9H2|LIPA_ECO55 Lipoyl synthase OS=Escherichia coli (strain 55989 / EAEC) GN=lipA PE=3 SV=1 87 374 6.0E-76
sp|B7MFQ1|LIPA_ECO45 Lipoyl synthase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=lipA PE=3 SV=1 87 374 6.0E-76
sp|B7UKR9|LIPA_ECO27 Lipoyl synthase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=lipA PE=3 SV=1 87 374 6.0E-76
sp|A7ZJ15|LIPA_ECO24 Lipoyl synthase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=lipA PE=3 SV=1 87 374 6.0E-76
sp|A5V2U6|LIPA_SPHWW Lipoyl synthase OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=lipA PE=3 SV=1 92 380 6.0E-76
sp|Q7N767|LIPA_PHOLL Lipoyl synthase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=lipA PE=3 SV=1 87 374 7.0E-76
sp|B2TTI9|LIPA_SHIB3 Lipoyl synthase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=lipA PE=3 SV=1 87 374 7.0E-76
sp|Q214R4|LIPA_RHOPB Lipoyl synthase OS=Rhodopseudomonas palustris (strain BisB18) GN=lipA PE=3 SV=1 94 378 8.0E-76
sp|Q821K6|LIPA_CHLCV Lipoyl synthase OS=Chlamydophila caviae (strain GPIC) GN=lipA PE=3 SV=1 83 399 8.0E-76
sp|A7MY96|LIPA_VIBCB Lipoyl synthase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=lipA PE=3 SV=1 87 374 9.0E-76
sp|Q1GYC1|LIPA_METFK Lipoyl synthase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=lipA PE=3 SV=1 92 374 9.0E-76
sp|Q7NFJ9|LIPA2_GLOVI Lipoyl synthase 2 OS=Gloeobacter violaceus (strain PCC 7421) GN=lipA2 PE=3 SV=1 91 376 1.0E-75
sp|B9LM70|LIPA_CHLSY Lipoyl synthase OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=lipA PE=3 SV=1 92 374 1.0E-75
sp|A9WEM1|LIPA_CHLAA Lipoyl synthase OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=lipA PE=3 SV=1 92 374 1.0E-75
sp|B3QIL2|LIPA_RHOPT Lipoyl synthase OS=Rhodopseudomonas palustris (strain TIE-1) GN=lipA PE=3 SV=1 94 378 1.0E-75
sp|P61198|LIPA_RHOPA Lipoyl synthase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=lipA PE=3 SV=1 94 378 1.0E-75
sp|Q8A029|LIPA_BACTN Lipoyl synthase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=lipA PE=3 SV=1 92 374 1.0E-75
sp|Q7V507|LIPA1_PROMM Lipoyl synthase 1 OS=Prochlorococcus marinus (strain MIT 9313) GN=lipA1 PE=3 SV=1 94 377 1.0E-75
sp|Q3SSP1|LIPA_NITWN Lipoyl synthase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=lipA PE=3 SV=1 94 378 1.0E-75
sp|Q7MWT4|LIPA_PORGI Lipoyl synthase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=lipA PE=3 SV=1 94 374 1.0E-75
sp|Q4ZN84|LIPA_PSEU2 Lipoyl synthase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=lipA PE=3 SV=1 90 376 1.0E-75
sp|Q48DM6|LIPA_PSE14 Lipoyl synthase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=lipA PE=3 SV=1 90 376 1.0E-75
sp|Q87RR1|LIPA_VIBPA Lipoyl synthase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=lipA PE=3 SV=1 87 374 1.0E-75
sp|B4RLK9|LIPA_NEIG2 Lipoyl synthase OS=Neisseria gonorrhoeae (strain NCCP11945) GN=lipA PE=3 SV=1 94 389 2.0E-75
sp|Q5F8I0|LIPA_NEIG1 Lipoyl synthase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=lipA PE=3 SV=1 94 389 2.0E-75
sp|C4LI04|LIPA_CORK4 Lipoyl synthase OS=Corynebacterium kroppenstedtii (strain DSM 44385 / CCUG 35717) GN=lipA PE=3 SV=1 81 406 2.0E-75
sp|B3H2J0|LIPA_ACTP7 Lipoyl synthase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=lipA PE=3 SV=1 94 374 2.0E-75
sp|A3N2P1|LIPA_ACTP2 Lipoyl synthase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=lipA PE=3 SV=1 94 374 2.0E-75
sp|Q11HV6|LIPA_CHESB Lipoyl synthase OS=Chelativorans sp. (strain BNC1) GN=lipA PE=3 SV=1 90 378 2.0E-75
sp|P73572|LIPA2_SYNY3 Lipoyl synthase 2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=lipA2 PE=3 SV=1 92 376 2.0E-75
sp|Q9JUC8|LIPA_NEIMA Lipoyl synthase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=lipA PE=3 SV=1 94 389 2.0E-75
sp|A6L1U8|LIPA_BACV8 Lipoyl synthase OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=lipA PE=3 SV=1 94 374 2.0E-75
sp|Q9RNY7|LIPA_ZYMMO Lipoyl synthase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=lipA PE=3 SV=2 89 378 3.0E-75
sp|A5G2D2|LIPA_ACICJ Lipoyl synthase OS=Acidiphilium cryptum (strain JF-5) GN=lipA PE=3 SV=1 83 378 3.0E-75
sp|A1AWI8|LIPA_RUTMC Lipoyl synthase OS=Ruthia magnifica subsp. Calyptogena magnifica GN=lipA PE=3 SV=1 80 374 3.0E-75
sp|Q3B3Y5|LIPA_CHLL7 Lipoyl synthase OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=lipA PE=3 SV=1 92 369 3.0E-75
sp|Q9JZA5|LIPA_NEIMB Lipoyl synthase OS=Neisseria meningitidis serogroup B (strain MC58) GN=lipA PE=3 SV=1 94 389 4.0E-75
sp|Q1QMA2|LIPA_NITHX Lipoyl synthase OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=lipA PE=3 SV=1 94 378 4.0E-75
sp|Q5FNM1|LIPA_GLUOX Lipoyl synthase OS=Gluconobacter oxydans (strain 621H) GN=lipA PE=3 SV=1 90 378 5.0E-75
sp|Q9PJI2|LIPA_CHLMU Lipoyl synthase OS=Chlamydia muridarum (strain MoPn / Nigg) GN=lipA PE=3 SV=1 92 386 5.0E-75
sp|B2RKU2|LIPA_PORG3 Lipoyl synthase OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=lipA PE=3 SV=1 94 374 6.0E-75
sp|A6TWC9|LIPA_ALKMQ Lipoyl synthase OS=Alkaliphilus metalliredigens (strain QYMF) GN=lipA PE=3 SV=1 89 378 8.0E-75
sp|A8H7D5|LIPA_SHEPA Lipoyl synthase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=lipA PE=3 SV=1 87 374 9.0E-75
sp|Q1LTM3|LIPA_BAUCH Lipoyl synthase OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=lipA PE=3 SV=1 94 374 9.0E-75
sp|Q5L4V4|LIPA_CHLAB Lipoyl synthase OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=lipA PE=3 SV=1 83 374 1.0E-74
sp|Q87VW7|LIPA_PSESM Lipoyl synthase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=lipA PE=3 SV=1 90 376 1.0E-74
sp|Q3ARP5|LIPA_CHLCH Lipoyl synthase OS=Chlorobium chlorochromatii (strain CaD3) GN=lipA PE=3 SV=2 88 382 2.0E-74
sp|Q5QYE5|LIPA_IDILO Lipoyl synthase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=lipA PE=3 SV=2 71 374 2.0E-74
sp|B8EJU1|LIPA_METSB Lipoyl synthase OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=lipA PE=3 SV=1 71 396 2.0E-74
sp|B1KDX3|LIPA_SHEWM Lipoyl synthase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=lipA PE=3 SV=1 87 374 2.0E-74
sp|B7KRC9|LIPA_METC4 Lipoyl synthase OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=lipA PE=3 SV=1 90 378 2.0E-74
sp|A9W6I4|LIPA_METEP Lipoyl synthase OS=Methylobacterium extorquens (strain PA1) GN=lipA PE=3 SV=1 90 378 2.0E-74
sp|B0TR57|LIPA_SHEHH Lipoyl synthase OS=Shewanella halifaxensis (strain HAW-EB4) GN=lipA PE=3 SV=1 87 374 2.0E-74
sp|B7VKE6|LIPA_VIBTL Lipoyl synthase OS=Vibrio tasmaniensis (strain LGP32) GN=lipA PE=3 SV=1 87 374 2.0E-74
sp|Q9KTF9|LIPA_VIBCH Lipoyl synthase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=lipA PE=3 SV=1 87 374 2.0E-74
sp|B8F679|LIPA_HAEPS Lipoyl synthase OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=lipA PE=3 SV=1 88 374 2.0E-74
sp|C3LTJ1|LIPA_VIBCM Lipoyl synthase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=lipA PE=3 SV=1 87 374 2.0E-74
sp|A5F2Y0|LIPA_VIBC3 Lipoyl synthase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=lipA PE=3 SV=1 87 374 2.0E-74
sp|Q1I4G1|LIPA_PSEE4 Lipoyl synthase OS=Pseudomonas entomophila (strain L48) GN=lipA PE=3 SV=1 90 376 3.0E-74
sp|A9LZ95|LIPA_NEIM0 Lipoyl synthase OS=Neisseria meningitidis serogroup C (strain 053442) GN=lipA PE=3 SV=1 94 376 3.0E-74
sp|A8FZ23|LIPA_SHESH Lipoyl synthase OS=Shewanella sediminis (strain HAW-EB3) GN=lipA PE=3 SV=1 87 374 3.0E-74
sp|Q137C6|LIPA_RHOPS Lipoyl synthase OS=Rhodopseudomonas palustris (strain BisB5) GN=lipA PE=3 SV=1 94 378 3.0E-74
sp|B1J144|LIPA_PSEPW Lipoyl synthase OS=Pseudomonas putida (strain W619) GN=lipA PE=3 SV=1 90 376 3.0E-74
sp|B8GMV6|LIPA_THISH Lipoyl synthase OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=lipA PE=3 SV=1 92 376 3.0E-74
sp|Q3J7W4|LIPA_NITOC Lipoyl synthase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=lipA PE=3 SV=1 92 374 3.0E-74
sp|Q8DL83|LIPA1_THEEB Lipoyl synthase 1 OS=Thermosynechococcus elongatus (strain BP-1) GN=lipA1 PE=3 SV=2 94 386 3.0E-74
sp|Q88DM5|LIPA_PSEPK Lipoyl synthase OS=Pseudomonas putida (strain KT2440) GN=lipA PE=3 SV=1 90 376 3.0E-74
sp|A5W9I5|LIPA_PSEP1 Lipoyl synthase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=lipA PE=3 SV=1 90 376 3.0E-74
sp|Q0APQ9|LIPA_MARMM Lipoyl synthase OS=Maricaulis maris (strain MCS10) GN=lipA PE=3 SV=1 83 378 4.0E-74
sp|Q2IW20|LIPA_RHOP2 Lipoyl synthase OS=Rhodopseudomonas palustris (strain HaA2) GN=lipA PE=3 SV=1 94 378 4.0E-74
sp|Q9HX25|LIPA_PSEAE Lipoyl synthase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=lipA PE=3 SV=1 90 376 4.0E-74
sp|Q02SG3|LIPA_PSEAB Lipoyl synthase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=lipA PE=3 SV=1 90 376 4.0E-74
sp|B7V9C1|LIPA_PSEA8 Lipoyl synthase OS=Pseudomonas aeruginosa (strain LESB58) GN=lipA PE=3 SV=1 90 376 4.0E-74
sp|Q6MEX3|LIPA_PARUW Lipoyl synthase OS=Protochlamydia amoebophila (strain UWE25) GN=lipA PE=3 SV=1 92 395 5.0E-74
sp|A6V0B4|LIPA_PSEA7 Lipoyl synthase OS=Pseudomonas aeruginosa (strain PA7) GN=lipA PE=3 SV=2 90 376 5.0E-74
sp|B8CSH7|LIPA_SHEPW Lipoyl synthase OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=lipA PE=3 SV=1 87 374 7.0E-74
sp|B1ZEL4|LIPA_METPB Lipoyl synthase OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=lipA PE=3 SV=1 90 378 7.0E-74
sp|Q7W0K8|LIPA_BORPE Lipoyl synthase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=lipA PE=3 SV=1 94 376 8.0E-74
sp|Q7WR00|LIPA_BORBR Lipoyl synthase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=lipA PE=3 SV=1 94 376 8.0E-74
sp|B0BRR9|LIPA_ACTPJ Lipoyl synthase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=lipA PE=3 SV=1 94 374 9.0E-74
sp|Q4FM35|LIPA_PELUB Lipoyl synthase OS=Pelagibacter ubique (strain HTCC1062) GN=lipA PE=3 SV=1 90 378 9.0E-74
sp|A4SJV5|LIPA_AERS4 Lipoyl synthase OS=Aeromonas salmonicida (strain A449) GN=lipA PE=3 SV=1 90 374 1.0E-73
sp|Q5E6V9|LIPA_VIBF1 Lipoyl synthase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=lipA PE=3 SV=1 87 374 1.0E-73
sp|Q8D325|LIPA_WIGBR Lipoyl synthase OS=Wigglesworthia glossinidia brevipalpis GN=lipA PE=3 SV=1 94 374 1.0E-73
sp|B9JW84|LIPA_AGRVS Lipoyl synthase OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=lipA PE=3 SV=1 90 378 1.0E-73
sp|Q2L1D8|LIPA_BORA1 Lipoyl synthase OS=Bordetella avium (strain 197N) GN=lipA PE=3 SV=1 94 376 1.0E-73
sp|Q7W222|LIPA_BORPA Lipoyl synthase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=lipA PE=3 SV=1 94 376 1.0E-73
sp|B1VHG8|LIPA_CORU7 Lipoyl synthase OS=Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109) GN=lipA PE=3 SV=1 94 404 1.0E-73
sp|A0KNA3|LIPA_AERHH Lipoyl synthase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=lipA PE=3 SV=1 90 374 1.0E-73
sp|Q8DLC2|LIPA2_THEEB Lipoyl synthase 2 OS=Thermosynechococcus elongatus (strain BP-1) GN=lipA2 PE=1 SV=1 93 376 1.0E-73
sp|C1DMR1|LIPA_AZOVD Lipoyl synthase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=lipA PE=3 SV=1 90 376 2.0E-73
sp|Q6ARK0|LIPA_DESPS Lipoyl synthase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=lipA PE=3 SV=1 94 378 2.0E-73
sp|A6X0M7|LIPA_OCHA4 Lipoyl synthase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=lipA PE=3 SV=1 80 378 3.0E-73
sp|B5FBJ6|LIPA_VIBFM Lipoyl synthase OS=Vibrio fischeri (strain MJ11) GN=lipA PE=3 SV=1 87 374 3.0E-73
sp|A3QH60|LIPA_SHELP Lipoyl synthase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=lipA PE=3 SV=1 87 374 3.0E-73
sp|B4SHB4|LIPA_PELPB Lipoyl synthase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=lipA PE=3 SV=1 94 374 3.0E-73
sp|A5UFJ8|LIPA_HAEIG Lipoyl synthase OS=Haemophilus influenzae (strain PittGG) GN=lipA PE=3 SV=1 88 374 3.0E-73
sp|Q5GVR7|LIPA_XANOR Lipoyl synthase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=lipA PE=3 SV=1 90 374 4.0E-73
sp|Q2NYZ2|LIPA_XANOM Lipoyl synthase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=lipA PE=3 SV=1 90 374 4.0E-73
sp|A5US48|LIPA_ROSS1 Lipoyl synthase OS=Roseiflexus sp. (strain RS-1) GN=lipA PE=3 SV=1 92 374 4.0E-73
sp|C5CCN0|LIPA_MICLC Lipoyl synthase OS=Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230) GN=lipA PE=3 SV=1 81 384 4.0E-73
sp|A0M4W4|LIPA_GRAFK Lipoyl synthase OS=Gramella forsetii (strain KT0803) GN=lipA PE=3 SV=1 94 374 5.0E-73
sp|A1S8U1|LIPA_SHEAM Lipoyl synthase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=lipA PE=3 SV=1 87 374 5.0E-73
sp|Q98MY2|LIPA_RHILO Lipoyl synthase OS=Rhizobium loti (strain MAFF303099) GN=lipA PE=3 SV=1 90 378 6.0E-73
sp|P44463|LIPA_HAEIN Lipoyl synthase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=lipA PE=3 SV=1 88 374 6.0E-73
sp|Q4QPL8|LIPA_HAEI8 Lipoyl synthase OS=Haemophilus influenzae (strain 86-028NP) GN=lipA PE=3 SV=1 88 374 7.0E-73
sp|Q8UFG1|LIPA_AGRFC Lipoyl synthase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=lipA PE=3 SV=1 90 378 7.0E-73
sp|A5FNF9|LIPA_FLAJ1 Lipoyl synthase OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=lipA PE=3 SV=1 94 379 7.0E-73
sp|Q3BXQ3|LIPA_XANC5 Lipoyl synthase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=lipA PE=3 SV=1 90 374 8.0E-73
sp|B0SQ03|LIPA_LEPBP Lipoyl synthase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=lipA PE=3 SV=1 93 380 8.0E-73
sp|B0SGV6|LIPA_LEPBA Lipoyl synthase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=lipA PE=3 SV=1 93 380 8.0E-73
sp|Q8PPL8|LIPA_XANAC Lipoyl synthase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=lipA PE=3 SV=1 90 374 8.0E-73
sp|Q9PDW0|LIPA_XYLFA Lipoyl synthase OS=Xylella fastidiosa (strain 9a5c) GN=lipA PE=3 SV=3 90 374 9.0E-73
sp|P57978|LIPA_PASMU Lipoyl synthase OS=Pasteurella multocida (strain Pm70) GN=lipA PE=3 SV=1 88 374 9.0E-73
sp|A8Z609|LIPA_SULMW Lipoyl synthase OS=Sulcia muelleri (strain GWSS) GN=lipA PE=3 SV=1 86 374 9.0E-73
sp|B3PYS0|LIPA_RHIE6 Lipoyl synthase OS=Rhizobium etli (strain CIAT 652) GN=lipA PE=3 SV=1 90 378 9.0E-73
sp|A6WD63|LIPA_KINRD Lipoyl synthase OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=lipA PE=3 SV=1 81 385 1.0E-72
sp|B0U641|LIPA_XYLFM Lipoyl synthase OS=Xylella fastidiosa (strain M12) GN=lipA PE=3 SV=1 90 374 1.0E-72
sp|Q87DZ9|LIPA_XYLFT Lipoyl synthase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=lipA PE=3 SV=1 90 374 1.0E-72
sp|B2I923|LIPA_XYLF2 Lipoyl synthase OS=Xylella fastidiosa (strain M23) GN=lipA PE=3 SV=1 90 374 1.0E-72
sp|B5ZNB1|LIPA_RHILW Lipoyl synthase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=lipA PE=3 SV=1 90 378 1.0E-72
sp|Q2K8V9|LIPA_RHIEC Lipoyl synthase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=lipA PE=3 SV=1 90 378 1.0E-72
sp|Q8P590|LIPA_XANCP Lipoyl synthase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=lipA PE=3 SV=1 90 374 1.0E-72
sp|Q4UYT2|LIPA_XANC8 Lipoyl synthase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=lipA PE=3 SV=1 90 374 1.0E-72
sp|A0L509|LIPA_MAGMM Lipoyl synthase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=lipA PE=3 SV=1 94 376 1.0E-72
sp|Q8EHQ6|LIPA_SHEON Lipoyl synthase OS=Shewanella oneidensis (strain MR-1) GN=lipA PE=3 SV=1 87 374 2.0E-72
sp|Q0HLK3|LIPA_SHESM Lipoyl synthase OS=Shewanella sp. (strain MR-4) GN=lipA PE=3 SV=1 87 374 2.0E-72
sp|A0KTV4|LIPA_SHESA Lipoyl synthase OS=Shewanella sp. (strain ANA-3) GN=lipA PE=3 SV=1 87 374 2.0E-72
sp|B0RNP9|LIPA_XANCB Lipoyl synthase OS=Xanthomonas campestris pv. campestris (strain B100) GN=lipA PE=3 SV=1 90 374 2.0E-72
sp|Q12QX1|LIPA_SHEDO Lipoyl synthase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=lipA PE=3 SV=1 87 374 2.0E-72
sp|A1RGT2|LIPA_SHESW Lipoyl synthase OS=Shewanella sp. (strain W3-18-1) GN=lipA PE=3 SV=1 87 374 2.0E-72
sp|A4Y9G2|LIPA_SHEPC Lipoyl synthase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=lipA PE=3 SV=1 87 374 2.0E-72
sp|Q484R8|LIPA_COLP3 Lipoyl synthase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=lipA PE=3 SV=1 89 374 2.0E-72
sp|Q82UJ5|LIPA_NITEU Lipoyl synthase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=lipA PE=3 SV=1 90 380 2.0E-72
sp|A5VQP8|LIPA_BRUO2 Lipoyl synthase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=lipA PE=3 SV=1 90 378 2.0E-72
sp|P65282|LIPA_BRUSU Lipoyl synthase OS=Brucella suis biovar 1 (strain 1330) GN=lipA PE=3 SV=1 90 378 3.0E-72
sp|B0CGS4|LIPA_BRUSI Lipoyl synthase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=lipA PE=3 SV=1 90 378 3.0E-72
sp|P65281|LIPA_BRUME Lipoyl synthase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=lipA PE=3 SV=1 90 378 3.0E-72
sp|C0RJ95|LIPA_BRUMB Lipoyl synthase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=lipA PE=3 SV=1 90 378 3.0E-72
sp|A9M5D7|LIPA_BRUC2 Lipoyl synthase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=lipA PE=3 SV=1 90 378 3.0E-72
sp|Q57D15|LIPA_BRUAB Lipoyl synthase OS=Brucella abortus biovar 1 (strain 9-941) GN=lipA PE=3 SV=1 90 378 3.0E-72
sp|Q2YPV8|LIPA_BRUA2 Lipoyl synthase OS=Brucella abortus (strain 2308) GN=lipA PE=3 SV=1 90 378 3.0E-72
sp|B2S5X5|LIPA_BRUA1 Lipoyl synthase OS=Brucella abortus (strain S19) GN=lipA PE=3 SV=1 90 378 3.0E-72
sp|Q0HXV7|LIPA_SHESR Lipoyl synthase OS=Shewanella sp. (strain MR-7) GN=lipA PE=3 SV=1 87 374 3.0E-72
sp|A6VM79|LIPA_ACTSZ Lipoyl synthase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=lipA PE=3 SV=1 76 374 3.0E-72
sp|B5EMR4|LIPA_ACIF5 Lipoyl synthase OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=lipA PE=3 SV=1 94 380 4.0E-72
sp|B7J7N7|LIPA_ACIF2 Lipoyl synthase OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=lipA PE=3 SV=1 94 380 4.0E-72
sp|A1BFY3|LIPA_CHLPD Lipoyl synthase OS=Chlorobium phaeobacteroides (strain DSM 266) GN=lipA PE=3 SV=1 90 374 4.0E-72
sp|A5UBB2|LIPA_HAEIE Lipoyl synthase OS=Haemophilus influenzae (strain PittEE) GN=lipA PE=3 SV=1 88 374 4.0E-72
sp|Q1MH26|LIPA_RHIL3 Lipoyl synthase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=lipA PE=3 SV=1 90 378 5.0E-72
sp|A1V016|LIPA_BURMS Lipoyl synthase OS=Burkholderia mallei (strain SAVP1) GN=lipA PE=3 SV=1 94 374 5.0E-72
[Show less]

GO

GO Term Description Terminal node
GO:0051536 iron-sulfur cluster binding Yes
GO:0003824 catalytic activity Yes
GO:0051540 metal cluster binding No
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.1595 0.1163 0.0337 0.0763 0.9494 0.1096 0.0331 0.0666 0.1296 0.0167

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2709
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6586
Ophiocordyceps australis map64 (Brazil) OphauB2|1500
Ophiocordyceps camponoti-floridani Ophcf2|02357
Ophiocordyceps camponoti-rufipedis Ophun1|698
Ophiocordyceps kimflemingae Ophio5|3505 (this protein)
Ophiocordyceps subramaniannii Hirsu2|4227

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3505
MAASSLRCARLALGARRSFATVPQPKDVVSSVDSDVSQKPQRKSYFKDTTVASFSDFLASSGAAASSLAPSDAYE
LRTAEVGPEGRRRTITRLPEWLKTPIPNSGNFKKIKADLRGLGLHTVCEEARCPNISECWGGSDKSAATATIMLM
GDTCTRGCRFCSVKTSRAPPPLDPHEPEHTAEALARWGLGYVVLTSVDRDDLVDGGAAHFAETIRKIKLKKPSLL
VEALTGDFAGNMDMVRLVADSGLDVYAHNVETVEGLTPYVRDRRATFRQSLNVLHHAKEVRGSQGIITKTSLMLG
LGEQEAEVTETLRELRKAGVDVVTFGQYMRPTKRHLKVERYVTPAEFELWRQRALDMGFLYCASGPLVRSSYKAG
EAFIENVLRKRAGGKTSSVGNASNIGEGLSDAVVFDSFS
Coding >Ophio5|3505
ATGGCTGCCTCGTCGCTGCGCTGCGCCCGCCTCGCCCTCGGCGCCAGACGCTCTTTCGCCACCGTGCCTCAGCCC
AAAGACGTCGTCTCCAGCGTCGACTCAGACGTGTCGCAGAAGCCTCAGCGGAAGAGCTACTTCAAGGATACGACT
GTCGCGTCCTTTTCGGATTTTCTGGCTTCGTCTGGAGCGGCGGCTTCGTCGTTGGCTCCCTCGGACGCGTACGAG
TTGCGGACTGCCGAGGTGGGACCCGAAGGGCGACGGCGTACCATCACGAGATTGCCGGAATGGTTGAAGACGCCG
ATCCCGAATAGCGGAAACTTTAAGAAGATCAAGGCTGACCTGCGTGGCCTGGGTCTGCATACCGTCTGCGAAGAG
GCGCGCTGTCCAAACATCTCGGAATGCTGGGGCGGTTCGGATAAGAGCGCGGCAACGGCGACCATCATGCTCATG
GGCGATACCTGTACGCGCGGTTGTCGCTTCTGTAGCGTAAAGACGAGTCGTGCGCCGCCGCCGCTGGATCCGCAT
GAACCGGAGCATACGGCCGAGGCCCTGGCTCGCTGGGGTTTGGGCTACGTCGTGCTGACGAGCGTGGATCGAGAT
GATCTGGTCGACGGGGGCGCTGCGCATTTCGCCGAGACGATTCGAAAGATTAAGCTCAAGAAGCCGTCACTGCTC
GTCGAGGCTCTGACTGGCGACTTTGCCGGGAACATGGATATGGTCCGCCTCGTCGCCGACAGCGGTCTTGATGTC
TACGCCCACAATGTCGAGACGGTCGAGGGTTTGACACCTTATGTGCGCGATAGGAGAGCTACTTTTCGTCAGAGC
CTCAATGTCCTCCACCACGCCAAAGAGGTCCGAGGCAGCCAAGGCATCATCACCAAAACGAGCCTCATGCTCGGT
CTAGGCGAGCAAGAAGCCGAAGTCACCGAAACCCTTCGAGAGCTCAGAAAAGCCGGCGTCGACGTCGTCACCTTT
GGCCAGTACATGCGTCCTACCAAGCGTCACCTCAAGGTGGAGCGCTACGTCACCCCGGCCGAGTTTGAACTCTGG
CGTCAGCGCGCTCTCGACATGGGCTTCCTTTATTGTGCCAGCGGGCCGCTCGTTCGTTCTTCCTACAAAGCTGGC
GAGGCCTTCATCGAGAATGTGCTGCGCAAGCGCGCGGGAGGCAAGACGTCCAGCGTCGGAAATGCGTCTAATATC
GGTGAGGGCTTGAGCGACGCCGTCGTCTTTGATTCGTTTTCA
Transcript >Ophio5|3505
ATGGCTGCCTCGTCGCTGCGCTGCGCCCGCCTCGCCCTCGGCGCCAGACGCTCTTTCGCCACCGTGCCTCAGCCC
AAAGACGTCGTCTCCAGCGTCGACTCAGACGTGTCGCAGAAGCCTCAGCGGAAGAGCTACTTCAAGGATACGACT
GTCGCGTCCTTTTCGGATTTTCTGGCTTCGTCTGGAGCGGCGGCTTCGTCGTTGGCTCCCTCGGACGCGTACGAG
TTGCGGACTGCCGAGGTGGGACCCGAAGGGCGACGGCGTACCATCACGAGATTGCCGGAATGGTTGAAGACGCCG
ATCCCGAATAGCGGAAACTTTAAGAAGATCAAGGCTGACCTGCGTGGCCTGGGTCTGCATACCGTCTGCGAAGAG
GCGCGCTGTCCAAACATCTCGGAATGCTGGGGCGGTTCGGATAAGAGCGCGGCAACGGCGACCATCATGCTCATG
GGCGATACCTGTACGCGCGGTTGTCGCTTCTGTAGCGTAAAGACGAGTCGTGCGCCGCCGCCGCTGGATCCGCAT
GAACCGGAGCATACGGCCGAGGCCCTGGCTCGCTGGGGTTTGGGCTACGTCGTGCTGACGAGCGTGGATCGAGAT
GATCTGGTCGACGGGGGCGCTGCGCATTTCGCCGAGACGATTCGAAAGATTAAGCTCAAGAAGCCGTCACTGCTC
GTCGAGGCTCTGACTGGCGACTTTGCCGGGAACATGGATATGGTCCGCCTCGTCGCCGACAGCGGTCTTGATGTC
TACGCCCACAATGTCGAGACGGTCGAGGGTTTGACACCTTATGTGCGCGATAGGAGAGCTACTTTTCGTCAGAGC
CTCAATGTCCTCCACCACGCCAAAGAGGTCCGAGGCAGCCAAGGCATCATCACCAAAACGAGCCTCATGCTCGGT
CTAGGCGAGCAAGAAGCCGAAGTCACCGAAACCCTTCGAGAGCTCAGAAAAGCCGGCGTCGACGTCGTCACCTTT
GGCCAGTACATGCGTCCTACCAAGCGTCACCTCAAGGTGGAGCGCTACGTCACCCCGGCCGAGTTTGAACTCTGG
CGTCAGCGCGCTCTCGACATGGGCTTCCTTTATTGTGCCAGCGGGCCGCTCGTTCGTTCTTCCTACAAAGCTGGC
GAGGCCTTCATCGAGAATGTGCTGCGCAAGCGCGCGGGAGGCAAGACGTCCAGCGTCGGAAATGCGTCTAATATC
GGTGAGGGCTTGAGCGACGCCGTCGTCTTTGATTCGTTTTCATGA
Gene >Ophio5|3505
ATGGCTGCCTCGTCGCTGCGCTGCGCCCGCCTCGCCCTCGGCGCCAGACGCTCTTTCGCCACCGTGCCTCAGCCC
AAAGACGTCGTCTCCAGCGTCGACTCAGACGTGTCGCAGAAGCCTCAGCGGAAGAGCTACTTCAAGGATACGACT
GTCGCGTCCTTTTCGGATTTTCTGGCTTCGTCTGGAGCGGCGGCTTCGTCGTTGGCTCCCTCGGACGCGTACGAG
TTGCGGACTGCCGAGGTGGGACCCGAAGGGCGACGGCGTACCATCACGAGATTGCCGGAATGGTTGAAGACGCCG
ATCCCGAATAGCGGAAACTTTAAGAAGATCAAGGCTGACCTGCGTGGCCTGGGTCTGCATACCGTCTGCGAAGAG
GCGCGCTGTCCAAACATCTCGGAATGCTGGGGCGGTTCGGATAAGAGCGCGGCAACGGCGACCATCATGCTCATG
GGCGATACCTGTACGCGCGGTTGTCGCTTCTGTAGCGTAAAGACGAGTCGTGCGCCGCCGCCGCTGGATCCGCAT
GAACCGGAGCATACGGCCGAGGCCCTGGCTCGCTGGGGTTTGGGCTACGTCGTGCTGACGAGCGTGGATCGAGAT
GATCTGGTCGACGGGGGCGCTGCGCATTTCGCCGAGACGATTCGAAAGATTAAGCTCAAGAAGCCGTCACTGCTC
GTCGAGGCTCTGACTGGCGACTTTGCCGGGAACATGGATATGGTCCGCCTCGTCGCCGACAGCGGTCTTGATGTC
TACGCCCACAATGTCGAGACGGTCGAGGGTTTGACACCTTATGTGCGCGATAGGAGAGCTACTTTTCGTCAGAGC
CTCAATGTCCTCCACCACGCCAAAGAGGTCCGAGGCAGCCAAGGCATCATCACCAAAACGAGCCTCATGCTCGGT
CTAGGCGAGCAAGAAGCCGAAGTCACCGAAACCCTTCGAGGTACGCTCTAGATCTCCGTCTACCTCCCTCTCTAT
CTTTCCTACCTTCTCGACCTCAAAAATTTTTTTTTCTAACCCAGCACCACAGAGCTCAGAAAAGCCGGCGTCGAC
GTCGTCACCTTTGGCCAGTACATGCGTCCTACCAAGCGTCACCTCAAGGTGGAGCGCTACGTCACCCCGGCCGAG
TTTGAACTCTGGCGTCAGCGCGCTCTCGACATGGGCTTCCTTTATTGTGCCAGCGGGCCGCTCGTTCGTTCTTCC
TACAAAGCTGGCGAGGCCTTCATCGAGAATGTGCTGCGCAAGCGCGCGGGAGGCAAGACGTCCAGCGTCGGAAAT
GCGTCTAATATCGGTGAGGGCTTGAGCGACGCCGTCGTCTTTGATTCGTTTTCATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail