Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3504
Gene name
Locationscaffold_278:17891..18356
Strand-
Gene length (bp)465
Transcript length (bp)465
Coding sequence length (bp)462
Protein length (aa) 154

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01083 Cutinase Cutinase 3.7E-09 71 134

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7G8|CUTI_PYRBR Cutinase OS=Pyrenopeziza brassicae PE=3 SV=1 56 126 5.0E-11
sp|Q8X1P1|CUTI_BLUGH Cutinase OS=Blumeria graminis f. sp. hordei GN=CUT1 PE=3 SV=1 69 144 1.0E-07
sp|Q8TGB8|CUTI_MONFR Cutinase OS=Monilinia fructicola GN=CUT1 PE=2 SV=1 71 146 1.0E-07
sp|P10951|CUTI_COLCA Cutinase OS=Colletotrichum capsici GN=CUTA PE=1 SV=1 46 132 2.0E-07
sp|Q00298|CUTI_BOTFU Cutinase OS=Botryotinia fuckeliana GN=cutA PE=3 SV=1 71 146 8.0E-06

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3504
MLRPLALLSLTAATLVIADDPPKANLVNKLADFFLDLPQFDYPVQGVCSLVAKRQQTMADEKKVQTTRTDSCGAI
TVIFARGSCEPGNVGISAGPPFFEALQNALGNRGRVAVNGLTYSADFKDFLTVEKDSGKQLSVSLCPFSLSLSLT
HVSR
Coding >Ophio5|3504
ATGCTACGCCCTCTAGCACTACTCAGCCTCACAGCGGCGACGCTCGTCATCGCCGATGACCCGCCCAAAGCCAAC
CTCGTCAACAAACTAGCCGACTTCTTCCTCGACCTGCCTCAGTTCGACTATCCCGTCCAGGGCGTCTGCTCCCTC
GTCGCCAAGCGGCAGCAGACCATGGCCGATGAGAAAAAGGTGCAGACTACTCGTACCGACTCTTGTGGCGCCATC
ACCGTCATCTTCGCCCGCGGATCCTGCGAGCCCGGAAACGTCGGAATATCCGCTGGGCCGCCTTTCTTCGAAGCT
CTGCAGAATGCGCTCGGCAATCGGGGTCGGGTCGCTGTCAATGGCTTGACGTATTCTGCCGACTTCAAGGACTTT
TTGACTGTTGAGAAAGACAGTGGGAAACAACTGTCAGTCAGCCTGTGCCCATTCTCTCTCTCCCTCTCCCTCACA
CATGTCTCCCGT
Transcript >Ophio5|3504
ATGCTACGCCCTCTAGCACTACTCAGCCTCACAGCGGCGACGCTCGTCATCGCCGATGACCCGCCCAAAGCCAAC
CTCGTCAACAAACTAGCCGACTTCTTCCTCGACCTGCCTCAGTTCGACTATCCCGTCCAGGGCGTCTGCTCCCTC
GTCGCCAAGCGGCAGCAGACCATGGCCGATGAGAAAAAGGTGCAGACTACTCGTACCGACTCTTGTGGCGCCATC
ACCGTCATCTTCGCCCGCGGATCCTGCGAGCCCGGAAACGTCGGAATATCCGCTGGGCCGCCTTTCTTCGAAGCT
CTGCAGAATGCGCTCGGCAATCGGGGTCGGGTCGCTGTCAATGGCTTGACGTATTCTGCCGACTTCAAGGACTTT
TTGACTGTTGAGAAAGACAGTGGGAAACAACTGTCAGTCAGCCTGTGCCCATTCTCTCTCTCCCTCTCCCTCACA
CATGTCTCCCGTTGA
Gene >Ophio5|3504
ATGCTACGCCCTCTAGCACTACTCAGCCTCACAGCGGCGACGCTCGTCATCGCCGATGACCCGCCCAAAGCCAAC
CTCGTCAACAAACTAGCCGACTTCTTCCTCGACCTGCCTCAGTTCGACTATCCCGTCCAGGGCGTCTGCTCCCTC
GTCGCCAAGCGGCAGCAGACCATGGCCGATGAGAAAAAGGTGCAGACTACTCGTACCGACTCTTGTGGCGCCATC
ACCGTCATCTTCGCCCGCGGATCCTGCGAGCCCGGAAACGTCGGAATATCCGCTGGGCCGCCTTTCTTCGAAGCT
CTGCAGAATGCGCTCGGCAATCGGGGTCGGGTCGCTGTCAATGGCTTGACGTATTCTGCCGACTTCAAGGACTTT
TTGACTGTTGAGAAAGACAGTGGGAAACAACTGTCAGTCAGCCTGTGCCCATTCTCTCTCTCCCTCTCCCTCACA
CATGTCTCCCGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail