Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3503
Gene name
Locationscaffold_278:17493..17694
Strand-
Gene length (bp)201
Transcript length (bp)201
Coding sequence length (bp)198
Protein length (aa) 66

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01083 Cutinase Cutinase 1.7E-14 2 66

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8X1P1|CUTI_BLUGH Cutinase OS=Blumeria graminis f. sp. hordei GN=CUT1 PE=3 SV=1 2 66 1.0E-12
sp|Q9Y7G8|CUTI_PYRBR Cutinase OS=Pyrenopeziza brassicae PE=3 SV=1 1 54 5.0E-11
sp|Q00298|CUTI_BOTFU Cutinase OS=Botryotinia fuckeliana GN=cutA PE=3 SV=1 2 54 2.0E-09
sp|Q8TGB8|CUTI_MONFR Cutinase OS=Monilinia fructicola GN=CUT1 PE=2 SV=1 8 62 3.0E-09
sp|A1DGN0|CUTI1_NEOFI Probable cutinase 1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NFIA_084890 PE=3 SV=1 4 66 3.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8X1P1|CUTI_BLUGH Cutinase OS=Blumeria graminis f. sp. hordei GN=CUT1 PE=3 SV=1 2 66 1.0E-12
sp|Q9Y7G8|CUTI_PYRBR Cutinase OS=Pyrenopeziza brassicae PE=3 SV=1 1 54 5.0E-11
sp|Q00298|CUTI_BOTFU Cutinase OS=Botryotinia fuckeliana GN=cutA PE=3 SV=1 2 54 2.0E-09
sp|Q8TGB8|CUTI_MONFR Cutinase OS=Monilinia fructicola GN=CUT1 PE=2 SV=1 8 62 3.0E-09
sp|A1DGN0|CUTI1_NEOFI Probable cutinase 1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NFIA_084890 PE=3 SV=1 4 66 3.0E-07
sp|Q4X1N0|CUTI1_ASPFU Probable cutinase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_2G09380 PE=3 SV=1 4 66 7.0E-07
sp|B0XRY3|CUTI1_ASPFC Probable cutinase 1 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=AFUB_025250 PE=3 SV=1 4 66 7.0E-07
sp|A1C9G0|CUTI3_ASPCL Probable cutinase 3 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ACLA_055320 PE=3 SV=1 2 66 4.0E-06
sp|Q5B2C1|CUTI1_EMENI Probable cutinase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN5309 PE=3 SV=1 3 66 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3503
MSRISSVVLFGDPYSKASVPSIDPGRVLVVCHDDDSICKGSQIVGMAHLTYGQDAQKAAGFVMSRL
Coding >Ophio5|3503
ATGTCGCGTATCAGCTCCGTCGTTCTCTTCGGCGACCCTTACTCCAAGGCCAGCGTCCCCTCCATCGACCCGGGC
CGAGTCCTGGTCGTCTGCCACGACGATGACAGCATCTGCAAGGGCAGTCAAATCGTCGGCATGGCCCACCTCACC
TACGGCCAGGATGCGCAGAAGGCCGCCGGCTTCGTTATGAGCAGGCTC
Transcript >Ophio5|3503
ATGTCGCGTATCAGCTCCGTCGTTCTCTTCGGCGACCCTTACTCCAAGGCCAGCGTCCCCTCCATCGACCCGGGC
CGAGTCCTGGTCGTCTGCCACGACGATGACAGCATCTGCAAGGGCAGTCAAATCGTCGGCATGGCCCACCTCACC
TACGGCCAGGATGCGCAGAAGGCCGCCGGCTTCGTTATGAGCAGGCTCTAG
Gene >Ophio5|3503
ATGTCGCGTATCAGCTCCGTCGTTCTCTTCGGCGACCCTTACTCCAAGGCCAGCGTCCCCTCCATCGACCCGGGC
CGAGTCCTGGTCGTCTGCCACGACGATGACAGCATCTGCAAGGGCAGTCAAATCGTCGGCATGGCCCACCTCACC
TACGGCCAGGATGCGCAGAAGGCCGCCGGCTTCGTTATGAGCAGGCTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail