Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3491
Gene name
Locationscaffold_277:13193..15376
Strand+
Gene length (bp)2183
Transcript length (bp)1875
Coding sequence length (bp)1872
Protein length (aa) 624

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 2.3E-37 92 463
PF00083 Sugar_tr Sugar (and other) transporter 2.3E-15 113 265

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q06451|TPO3_YEAST Polyamine transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO3 PE=1 SV=1 71 522 3.0E-64
sp|P53283|TPO2_YEAST Polyamine transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO2 PE=1 SV=1 71 533 2.0E-63
sp|O59814|YCT4_SCHPO Uncharacterized transporter C794.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.04c PE=3 SV=1 28 523 1.0E-57
sp|O59698|YN41_SCHPO Uncharacterized transporter C36.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.01c PE=1 SV=1 68 524 2.0E-57
sp|O59738|YN22_SCHPO Uncharacterized transporter C530.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.02 PE=3 SV=1 71 529 3.0E-54
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q06451|TPO3_YEAST Polyamine transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO3 PE=1 SV=1 71 522 3.0E-64
sp|P53283|TPO2_YEAST Polyamine transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO2 PE=1 SV=1 71 533 2.0E-63
sp|O59814|YCT4_SCHPO Uncharacterized transporter C794.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.04c PE=3 SV=1 28 523 1.0E-57
sp|O59698|YN41_SCHPO Uncharacterized transporter C36.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.01c PE=1 SV=1 68 524 2.0E-57
sp|O59738|YN22_SCHPO Uncharacterized transporter C530.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.02 PE=3 SV=1 71 529 3.0E-54
sp|Q10487|MFS1_SCHPO Transporter mfs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs1 PE=3 SV=1 44 525 4.0E-54
sp|O74829|YN2F_SCHPO Uncharacterized MFS-type transporter C530.15c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.15c PE=1 SV=2 71 524 5.0E-54
sp|Q9P3V5|YI45_SCHPO Uncharacterized transporter C1348.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1348.05 PE=3 SV=1 71 533 1.0E-53
sp|P38124|FLR1_YEAST Fluconazole resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLR1 PE=1 SV=1 71 528 3.0E-53
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 52 506 5.0E-53
sp|Q5ABU7|MDR1_CANAL Multidrug resistance protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MDR1 PE=1 SV=1 71 525 6.0E-53
sp|P28873|BMRP_CANAX Benomyl/methotrexate resistance protein OS=Candida albicans GN=MDR1 PE=3 SV=1 71 525 6.0E-53
sp|Q9P3E8|YLZ2_SCHPO Uncharacterized transporter C750.02c/PB2B2.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC750.02c PE=3 SV=1 71 533 7.0E-53
sp|Q9Y7S4|YQO5_SCHPO Uncharacterized transporter C569.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC569.05c PE=3 SV=1 60 524 4.0E-52
sp|O94528|CAF5_SCHPO Caffeine resistance protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=caf5 PE=3 SV=1 52 525 7.0E-52
sp|O59699|YN42_SCHPO Uncharacterized transporter C36.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.02c PE=3 SV=1 68 524 3.0E-51
sp|Q12256|TPO4_YEAST Polyamine transporter 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO4 PE=1 SV=1 71 525 4.0E-51
sp|O43081|YHS6_SCHPO Uncharacterized MFS-type transporter C947.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC947.06c PE=3 SV=1 69 529 4.0E-50
sp|Q7Z9I0|YHA8_SCHPO Uncharacterized MFS-type transporter C409.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC409.08 PE=3 SV=1 41 524 6.0E-50
sp|Q10084|MFS2_SCHPO Uncharacterized transporter mfs2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs2 PE=3 SV=1 71 529 6.0E-50
sp|O59700|YN43_SCHPO Uncharacterized transporter C36.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.03c PE=3 SV=1 19 524 6.0E-50
sp|P32071|CYHR_CANMA Cycloheximide resistance protein OS=Candida maltosa GN=CYHR PE=3 SV=1 4 525 7.0E-49
sp|P38776|YHK8_YEAST Probable drug/proton antiporter YHK8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHK8 PE=1 SV=1 88 523 4.0E-44
sp|Q07824|TPO1_YEAST Polyamine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO1 PE=1 SV=1 53 525 2.0E-43
sp|Q9HDX4|MFC1_SCHPO Uncharacterized transporter mfc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfc1 PE=3 SV=2 70 501 2.0E-41
sp|O59833|YCUD_SCHPO Uncharacterized transporter C965.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC965.13 PE=3 SV=1 53 524 8.0E-36
sp|O74899|YQEH_SCHPO Uncharacterized transporter C576.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC576.17c PE=1 SV=1 74 533 6.0E-32
sp|P33532|BSU1_SCHPO Vitamin B6 transporter bsu1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bsu1 PE=3 SV=2 50 523 1.0E-25
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 71 269 4.0E-23
sp|P38227|QDR3_YEAST Quinidine resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR3 PE=1 SV=2 77 292 1.0E-18
sp|P38125|DTR1_YEAST Dityrosine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DTR1 PE=1 SV=1 34 513 6.0E-15
sp|P53943|AQR1_YEAST Probable transporter AQR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AQR1 PE=1 SV=1 52 369 2.0E-12
sp|P40475|QDR1_YEAST Quinidine resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR1 PE=1 SV=1 31 525 4.0E-12
sp|G2TRN8|YI74_SCHPO Putative uncharacterized transporter C977.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC977.04 PE=5 SV=1 392 532 1.0E-11
sp|O52733|XYLT_LACBR D-xylose-proton symporter OS=Lactobacillus brevis GN=xylT PE=3 SV=1 84 302 2.0E-10
sp|A7MJD1|NANT_CROS8 Putative sialic acid transporter OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=nanT PE=3 SV=1 105 333 2.0E-09
sp|P96712|BMR3_BACSU Multidrug resistance protein 3 OS=Bacillus subtilis (strain 168) GN=bmr3 PE=1 SV=1 97 268 6.0E-09
sp|P53389|HOL1_YEAST Protein HOL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOL1 PE=1 SV=1 48 265 1.0E-08
sp|A4TMJ0|NANT_YERPP Putative sialic acid transporter OS=Yersinia pestis (strain Pestoides F) GN=nanT PE=3 SV=1 105 306 2.0E-08
sp|P71369|Y1104_HAEIN Putative metabolite transport protein HI_1104 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1104 PE=3 SV=1 71 248 2.0E-08
sp|P40474|QDR2_YEAST Quinidine resistance protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR2 PE=1 SV=1 83 528 3.0E-08
sp|Q8FDU9|NANT2_ECOL6 Putative sialic acid transporter 2 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=nanT2 PE=3 SV=1 105 348 3.0E-08
sp|P28246|BCR_ECOLI Bicyclomycin resistance protein OS=Escherichia coli (strain K12) GN=bcr PE=1 SV=4 107 296 3.0E-08
sp|O94343|YHMA_SCHPO Uncharacterized MFS-type transporter C1271.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.10c PE=1 SV=1 71 541 4.0E-08
sp|Q668K2|NANT_YERPS Putative sialic acid transporter OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=nanT PE=3 SV=1 105 306 9.0E-08
sp|A9QZJ2|NANT_YERPG Putative sialic acid transporter OS=Yersinia pestis bv. Antiqua (strain Angola) GN=nanT PE=3 SV=1 105 306 9.0E-08
sp|B2K942|NANT_YERPB Putative sialic acid transporter OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=nanT PE=3 SV=1 105 306 9.0E-08
sp|A7FG99|NANT_YERP3 Putative sialic acid transporter OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=nanT PE=3 SV=1 105 306 9.0E-08
sp|Q8ZCH3|NANT_YERPE Putative sialic acid transporter OS=Yersinia pestis GN=nanT PE=3 SV=1 105 306 9.0E-08
sp|Q1C5V2|NANT_YERPA Putative sialic acid transporter OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=nanT PE=3 SV=1 105 306 9.0E-08
sp|P54585|YHCA_BACSU Uncharacterized MFS-type transporter YhcA OS=Bacillus subtilis (strain 168) GN=yhcA PE=3 SV=2 69 373 1.0E-07
sp|B1JFW5|NANT_YERPY Putative sialic acid transporter OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=nanT PE=3 SV=1 105 306 1.0E-07
sp|P94493|YNCC_BACSU Putative metabolite transport protein YncC OS=Bacillus subtilis (strain 168) GN=yncC PE=3 SV=2 121 265 2.0E-07
sp|Q59YT1|QDR2_CANAL MFS antiporter QDR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR2 PE=3 SV=1 56 302 2.0E-07
sp|Q95R48|OCTL_DROME Organic cation transporter-like protein OS=Drosophila melanogaster GN=Orct2 PE=2 SV=2 128 309 3.0E-07
sp|Q9VCA2|ORCT_DROME Organic cation transporter protein OS=Drosophila melanogaster GN=Orct PE=1 SV=1 128 276 4.0E-07
sp|P54723|YFIG_BACSU Putative metabolite transport protein YfiG OS=Bacillus subtilis (strain 168) GN=yfiG PE=3 SV=1 121 265 5.0E-07
sp|P44927|EMRB_HAEIN Multidrug export protein EmrB OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=emrB PE=3 SV=1 95 246 9.0E-07
sp|A9MNY7|NANT_SALAR Putative sialic acid transporter OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=nanT PE=3 SV=1 105 256 1.0E-06
sp|B5BGP4|NANT_SALPK Putative sialic acid transporter OS=Salmonella paratyphi A (strain AKU_12601) GN=nanT PE=3 SV=1 105 256 1.0E-06
sp|Q5PLF0|NANT_SALPA Putative sialic acid transporter OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=nanT PE=3 SV=1 105 256 1.0E-06
sp|Q57JD0|NANT_SALCH Putative sialic acid transporter OS=Salmonella choleraesuis (strain SC-B67) GN=nanT PE=3 SV=1 105 256 2.0E-06
sp|B4TWI9|NANT_SALSV Putative sialic acid transporter OS=Salmonella schwarzengrund (strain CVM19633) GN=nanT PE=3 SV=1 105 256 2.0E-06
sp|C0PZN3|NANT_SALPC Putative sialic acid transporter OS=Salmonella paratyphi C (strain RKS4594) GN=nanT PE=3 SV=1 105 256 2.0E-06
sp|B5FIR7|NANT_SALDC Putative sialic acid transporter OS=Salmonella dublin (strain CT_02021853) GN=nanT PE=3 SV=1 105 256 2.0E-06
sp|B5R0L1|NANT_SALEP Putative sialic acid transporter OS=Salmonella enteritidis PT4 (strain P125109) GN=nanT PE=3 SV=1 105 256 2.0E-06
sp|B5RET6|NANT_SALG2 Putative sialic acid transporter OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=nanT PE=3 SV=1 105 256 2.0E-06
sp|B4T749|NANT_SALNS Putative sialic acid transporter OS=Salmonella newport (strain SL254) GN=nanT PE=3 SV=1 105 256 2.0E-06
sp|A9N832|NANT_SALPB Putative sialic acid transporter OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=nanT PE=3 SV=1 105 256 2.0E-06
sp|P0A2G6|NANT_SALTI Putative sialic acid transporter OS=Salmonella typhi GN=nanT PE=3 SV=1 105 256 2.0E-06
sp|P0A2G5|NANT_SALTY Putative sialic acid transporter OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=nanT PE=3 SV=1 105 256 2.0E-06
sp|B4TJR2|NANT_SALHS Putative sialic acid transporter OS=Salmonella heidelberg (strain SL476) GN=nanT PE=3 SV=1 105 256 2.0E-06
sp|C0SPB2|YWTG_BACSU Putative metabolite transport protein YwtG OS=Bacillus subtilis (strain 168) GN=ywtG PE=3 SV=1 101 265 3.0E-06
sp|A8AQB4|NANT_CITK8 Putative sialic acid transporter OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=nanT PE=3 SV=1 105 256 4.0E-06
sp|P45123|BCR_HAEIN Bicyclomycin resistance protein homolog OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=bcr PE=3 SV=1 103 279 5.0E-06
sp|P9WG89|EMRB_MYCTU Multidrug resistance protein B homolog OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=emrB PE=3 SV=1 105 260 5.0E-06
sp|P0AEJ0|EMRB_ECOLI Multidrug export protein EmrB OS=Escherichia coli (strain K12) GN=emrB PE=1 SV=1 91 373 5.0E-06
sp|P0AEJ1|EMRB_ECO57 Multidrug export protein EmrB OS=Escherichia coli O157:H7 GN=emrB PE=3 SV=1 91 373 5.0E-06
sp|P9WG88|EMRB_MYCTO Multidrug resistance protein B homolog OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=emrB PE=3 SV=1 105 260 5.0E-06
sp|B7LRJ2|NANT_ESCF3 Putative sialic acid transporter OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=nanT PE=3 SV=1 105 256 7.0E-06
sp|B5F7J8|NANT_SALA4 Putative sialic acid transporter OS=Salmonella agona (strain SL483) GN=nanT PE=3 SV=1 105 256 9.0E-06
sp|Q01440|GTR1_LEIDO Membrane transporter D1 OS=Leishmania donovani PE=3 SV=1 86 265 9.0E-06
sp|Q8FD59|NANT1_ECOL6 Putative sialic acid transporter 1 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=nanT1 PE=3 SV=2 105 256 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 38 0.45

Transmembrane Domains

Domain # Start End Length
1 86 108 22
2 123 145 22
3 152 174 22
4 178 200 22
5 212 234 22
6 249 271 22
7 319 341 22
8 354 376 22
9 397 419 22
10 429 451 22
11 472 491 19
12 496 518 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 16.24 7.44 25.04
CcL In ants, during behavior modification 14.60 6.31 22.89
CcD In ants, recently dead 7.79 2.94 12.64

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.749835 no
SC16a CcD 0.010908 yes
CcL CcD 0.032440 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3491
MPEDYVCPLCMIDPKAKMDLAIQDEGALHHKTHSVTAQPMYAKDSGFGIIHDSRPESKNPTARDVPAWELDAENP
YNWPAWKKGLVLFISALAVFNSTMGSAIPSIAITSIASEFGIDSAVQKALPISLFLLGYVFGPLVWGPLSEHMGR
RQLTLATFALFMLFTMACAMAPAWWALLVFRTLAGIFGSSPFAVVAGILADMFGEPRTRGRAFALFTTAITFGPC
LAPIVSALASSTIGWRWAFWVALIVAGITLWALYFLLPETLGHVLLARSRRRMPPNGAADMTDALPRHDPVNASP
SVLAVVLSRPLRMLVCEPIVSASCAHLALSYAIFYVSFQAFPLVFQGLHGLPPGVAGLCFLPIGVGACLTLPVFW
YWDVVVVRARTRGAPWAESDEYRRLPLVVLGGPLFALSLFWFGFSARRPVHFVVPLLAGVPFGAGFVFIYTALVN
YLTDAYHVFAASAHAAASCSRSLFAVLLPLVSPLLFSRLGISGACALLGGLSTVMCLIPFVFIYKGPVLRRRSRF
RRRLDPADGVPVFDQRLYSQEPGRPRYDKEAEVAGTVKAWGAENILGRGCDGKRQGSLTPTLQLRQSGSTYAKTT
QMEMKFTELGHSRVREDSNQAGKD
Coding >Ophio5|3491
ATGCCCGAAGACTATGTCTGCCCTCTCTGCATGATAGATCCTAAGGCCAAGATGGACCTAGCTATCCAAGACGAG
GGAGCACTGCACCACAAGACACACTCTGTTACCGCCCAACCCATGTACGCCAAGGACAGCGGCTTTGGCATCATC
CACGACAGTCGTCCGGAATCCAAGAACCCGACGGCTCGAGACGTACCCGCGTGGGAGCTTGACGCTGAGAACCCA
TACAACTGGCCAGCGTGGAAAAAAGGCCTTGTCCTCTTCATATCAGCCTTGGCCGTCTTCAATTCAACCATGGGC
TCAGCCATACCCAGCATCGCCATTACCAGCATCGCCAGCGAGTTCGGCATAGACTCGGCCGTACAAAAGGCGCTG
CCTATCTCTCTCTTCCTTCTCGGCTACGTCTTCGGTCCCCTTGTCTGGGGGCCCCTGAGCGAGCACATGGGACGA
CGGCAGCTGACGTTGGCCACTTTTGCCTTGTTCATGCTCTTCACCATGGCCTGTGCCATGGCGCCGGCTTGGTGG
GCGCTTCTCGTCTTCCGCACCCTCGCCGGCATCTTCGGCAGTTCGCCTTTTGCCGTCGTCGCCGGCATCTTGGCA
GACATGTTTGGCGAGCCACGGACTAGGGGTCGGGCCTTCGCCCTCTTCACCACTGCCATCACCTTCGGCCCCTGT
CTCGCCCCCATCGTCTCTGCCTTGGCCTCGTCGACCATCGGCTGGCGCTGGGCCTTTTGGGTTGCCCTCATCGTC
GCCGGTATCACGCTTTGGGCGCTCTACTTCCTGCTGCCAGAGACGCTGGGCCACGTCCTGCTGGCGCGCAGCCGT
CGCCGGATGCCCCCGAACGGTGCCGCCGATATGACGGACGCCCTCCCTCGACACGACCCTGTCAACGCTAGCCCC
TCGGTTCTCGCCGTGGTGTTGAGCCGGCCGCTCCGGATGCTAGTATGCGAGCCCATAGTCTCCGCCTCGTGCGCC
CATCTCGCCCTCTCCTACGCCATCTTCTACGTCTCTTTCCAGGCCTTTCCCCTCGTCTTCCAGGGCCTCCACGGC
CTGCCGCCCGGTGTCGCTGGCCTGTGCTTCCTGCCCATCGGCGTCGGCGCCTGTCTCACCTTGCCCGTCTTCTGG
TACTGGGATGTCGTCGTCGTTCGGGCCCGGACCCGCGGCGCGCCTTGGGCGGAGAGTGACGAGTACCGCCGCCTG
CCGCTCGTCGTCTTGGGCGGGCCGCTCTTCGCTCTCTCCCTATTCTGGTTTGGTTTCTCTGCCCGCCGGCCCGTT
CATTTCGTCGTGCCCTTGTTAGCGGGCGTTCCCTTTGGCGCCGGCTTTGTCTTCATCTACACGGCGCTCGTCAAC
TACCTCACCGACGCATATCACGTCTTCGCCGCCTCCGCACATGCCGCCGCCTCGTGTTCGCGCTCCCTCTTTGCC
GTCCTCCTTCCGCTGGTCTCCCCGCTCCTCTTCTCCCGTCTCGGCATCTCCGGCGCATGTGCCCTCCTCGGCGGC
CTGAGCACCGTCATGTGTCTCATTCCATTCGTCTTCATCTACAAGGGGCCTGTCCTCAGGCGTCGCTCGCGCTTT
CGCCGTCGCCTTGATCCAGCCGATGGGGTCCCTGTCTTCGACCAACGACTCTATTCGCAAGAGCCAGGGAGGCCA
AGATATGATAAAGAGGCAGAGGTGGCGGGAACCGTAAAGGCATGGGGCGCAGAAAACATTCTAGGCAGAGGCTGC
GATGGCAAGAGGCAAGGATCGCTCACACCGACGTTACAGTTGCGGCAGTCAGGAAGCACATACGCAAAGACCACT
CAGATGGAGATGAAGTTCACGGAGCTCGGTCACTCACGTGTCAGAGAGGACAGCAACCAAGCAGGCAAGGAC
Transcript >Ophio5|3491
ATGCCCGAAGACTATGTCTGCCCTCTCTGCATGATAGATCCTAAGGCCAAGATGGACCTAGCTATCCAAGACGAG
GGAGCACTGCACCACAAGACACACTCTGTTACCGCCCAACCCATGTACGCCAAGGACAGCGGCTTTGGCATCATC
CACGACAGTCGTCCGGAATCCAAGAACCCGACGGCTCGAGACGTACCCGCGTGGGAGCTTGACGCTGAGAACCCA
TACAACTGGCCAGCGTGGAAAAAAGGCCTTGTCCTCTTCATATCAGCCTTGGCCGTCTTCAATTCAACCATGGGC
TCAGCCATACCCAGCATCGCCATTACCAGCATCGCCAGCGAGTTCGGCATAGACTCGGCCGTACAAAAGGCGCTG
CCTATCTCTCTCTTCCTTCTCGGCTACGTCTTCGGTCCCCTTGTCTGGGGGCCCCTGAGCGAGCACATGGGACGA
CGGCAGCTGACGTTGGCCACTTTTGCCTTGTTCATGCTCTTCACCATGGCCTGTGCCATGGCGCCGGCTTGGTGG
GCGCTTCTCGTCTTCCGCACCCTCGCCGGCATCTTCGGCAGTTCGCCTTTTGCCGTCGTCGCCGGCATCTTGGCA
GACATGTTTGGCGAGCCACGGACTAGGGGTCGGGCCTTCGCCCTCTTCACCACTGCCATCACCTTCGGCCCCTGT
CTCGCCCCCATCGTCTCTGCCTTGGCCTCGTCGACCATCGGCTGGCGCTGGGCCTTTTGGGTTGCCCTCATCGTC
GCCGGTATCACGCTTTGGGCGCTCTACTTCCTGCTGCCAGAGACGCTGGGCCACGTCCTGCTGGCGCGCAGCCGT
CGCCGGATGCCCCCGAACGGTGCCGCCGATATGACGGACGCCCTCCCTCGACACGACCCTGTCAACGCTAGCCCC
TCGGTTCTCGCCGTGGTGTTGAGCCGGCCGCTCCGGATGCTAGTATGCGAGCCCATAGTCTCCGCCTCGTGCGCC
CATCTCGCCCTCTCCTACGCCATCTTCTACGTCTCTTTCCAGGCCTTTCCCCTCGTCTTCCAGGGCCTCCACGGC
CTGCCGCCCGGTGTCGCTGGCCTGTGCTTCCTGCCCATCGGCGTCGGCGCCTGTCTCACCTTGCCCGTCTTCTGG
TACTGGGATGTCGTCGTCGTTCGGGCCCGGACCCGCGGCGCGCCTTGGGCGGAGAGTGACGAGTACCGCCGCCTG
CCGCTCGTCGTCTTGGGCGGGCCGCTCTTCGCTCTCTCCCTATTCTGGTTTGGTTTCTCTGCCCGCCGGCCCGTT
CATTTCGTCGTGCCCTTGTTAGCGGGCGTTCCCTTTGGCGCCGGCTTTGTCTTCATCTACACGGCGCTCGTCAAC
TACCTCACCGACGCATATCACGTCTTCGCCGCCTCCGCACATGCCGCCGCCTCGTGTTCGCGCTCCCTCTTTGCC
GTCCTCCTTCCGCTGGTCTCCCCGCTCCTCTTCTCCCGTCTCGGCATCTCCGGCGCATGTGCCCTCCTCGGCGGC
CTGAGCACCGTCATGTGTCTCATTCCATTCGTCTTCATCTACAAGGGGCCTGTCCTCAGGCGTCGCTCGCGCTTT
CGCCGTCGCCTTGATCCAGCCGATGGGGTCCCTGTCTTCGACCAACGACTCTATTCGCAAGAGCCAGGGAGGCCA
AGATATGATAAAGAGGCAGAGGTGGCGGGAACCGTAAAGGCATGGGGCGCAGAAAACATTCTAGGCAGAGGCTGC
GATGGCAAGAGGCAAGGATCGCTCACACCGACGTTACAGTTGCGGCAGTCAGGAAGCACATACGCAAAGACCACT
CAGATGGAGATGAAGTTCACGGAGCTCGGTCACTCACGTGTCAGAGAGGACAGCAACCAAGCAGGCAAGGACTAA
Gene >Ophio5|3491
ATGCCCGAAGACTATGTCTGCCCTCTCTGCATGATAGATCCGTATGCCTTTACTTCTGCCCTGAACTTTTGATCG
AGTGAAGCAAGCTTACCAAGGTAGTAAGGCCAAGATGGACCTAGCTATCCAAGACGAGGGTGCGTGTGACAGTTC
CTCATCATGGACTAACTAATTTATTGACGGTTTGCAGGAGCACTGCACCACAAGACACACTCTGTTACCGCCCAA
CCCATGTACGCCAAGGACAGCGGCTTTGGCATCATCCACGACAGTCGTCCGGAATCCAAGAACCCGACGGCTCGA
GACGTACCCGCGTGGGAGCTTGACGCTGAGAACCCATACAACTGGCCAGCGGTGAGCGCGCCCCCTCGTCAGGCA
TCGACCCTAGACTCTGACGAACGGCGCAGTGGAAAAAAGGCCTTGTCCTCTTCATATCAGCCTTGGCCGTCTTCA
ATTCAACCATGGGCTCAGCCATACCCAGCATCGCCATTACCAGCATCGCCAGCGAGTTCGGCATAGACTCGGCCG
TACAAAAGGCGCTGCCTATCTCTCTCTTCCTTCTCGGCTACGTCTTCGGTCCCCTTGTCTGGGGGCCCCTGAGCG
AGCACATGGGACGACGGCAGCTGACGTTGGCCACTTTTGCCTTGTTCATGCTCTTCACCATGGCCTGTGCCATGG
CGCCGGCTTGGTGGGCGCTTCTCGTCTTCCGCACCCTCGCCGGCATCTTCGGCAGTTCGCCTTTTGCCGTCGTCG
CCGGCATCTTGGCAGACATGTTTGGCGAGCCACGGACTAGGGGTCGGGCCTTCGCCCTCTTCACCACTGTACGTT
CTTATGTATTTATTTTATCTATTTTATCTTACCTCTCGCTTGCTGTTCTTGTTGTTTACCAAGGTGAGAGCAGGC
CATCACCTTCGGCCCCTGTCTCGCCCCCATCGTCTCTGCCTTGGCCTCGTCGACCATCGGCTGGCGCTGGGCCTT
TTGGGTTGCCCTCATCGTCGCCGGTATCACGCTTTGGGCGCTCTACTTCCTGCTGCCAGAGACGCTGGGCCACGT
CCTGCTGGCGCGCAGCCGTCGCCGGATGCCCCCGAACGGTGCCGCCGATATGACGGACGCCCTCCCTCGACACGA
CCCTGTCAACGCTAGCCCCTCGGTTCTCGCCGTGGTGTTGAGCCGGCCGCTCCGGATGCTAGTATGCGAGCCCAT
AGTCTCCGCCTCGTGCGCCCATCTCGCCCTCTCCTACGCCATCTTCTACGTCTCTTTCCAGGCCTTTCCCCTCGT
CTTCCAGGGCCTCCACGGCCTGCCGCCCGGTGTCGCTGGCCTGTGCTTCCTGCCCATCGGCGTCGGCGCCTGTCT
CACCTTGCCCGTCTTCTGGTACTGGGATGTCGTCGTCGTTCGGGCCCGGACCCGCGGCGCGCCTTGGGCGGAGAG
TGACGAGTACCGCCGCCTGCCGCTCGTCGTCTTGGGCGGGCCGCTCTTCGCTCTCTCCCTATTCTGGTTTGGTTT
CTCTGCCCGCCGGCCCGTTCATTTCGTCGTGCCCTTGTTAGCGGGCGTTCCCTTTGGCGCCGGCTTTGTCTTCAT
CTACACGGCGCTCGTCAACTACCTCACCGACGCATATCACGTCTTCGCCGCCTCCGCACATGCCGCCGCCTCGTG
TTCGCGCTCCCTCTTTGCCGTCCTCCTTCCGCTGGTCTCCCCGCTCCTCTTCTCCCGTCTCGGCATCTCCGGCGC
ATGTGCCCTCCTCGGCGGCCTGAGCACCGTCATGTGTCTCATTCCATTCGTCTTCATCTACAAGGGGCCTGTCCT
CAGGCGTCGCTCGCGCTTTCGCCGTCGCCTTGATCCAGCCGATGGGGTCCCTGTCTTCGACCAACGACTCTATTC
GCAAGAGCCAGGGAGGCCAAGATATGATAAAGAGGCAGAGGTGGCGGGAACCGTAAAGGCATGGGGCGCAGAAAA
CATTCTAGGCAGAGGCTGCGATGGCAAGAGGCAAGGATCGCTCACACCGACGTTACAGTTGCGGCAGTCAGGAAG
CACATACGTAGGTCGTGATGGTGCAGGCGGAGACTGCATGCCGTGGTACACTGAAGGCAGACATGGCACAGGCAA
AGACCACTCAGATGGAGATGAAGTTCACGGAGCTCGGTCACTCACGTGTCAGAGAGGACAGCAACCAAGCAGGCA
AGGACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail