Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3487
Gene name
Locationscaffold_277:4969..8531
Strand-
Gene length (bp)3562
Transcript length (bp)3342
Coding sequence length (bp)3339
Protein length (aa) 1113

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00012 HSP70 Hsp70 protein 1.8E-52 114 754

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7ZUW2|HYOU1_DANRE Hypoxia up-regulated protein 1 OS=Danio rerio GN=hyou1 PE=2 SV=1 113 923 6.0E-95
sp|Q63617|HYOU1_RAT Hypoxia up-regulated protein 1 OS=Rattus norvegicus GN=Hyou1 PE=1 SV=1 83 923 7.0E-88
sp|Q60432|HYOU1_CRIGR Hypoxia up-regulated protein 1 OS=Cricetulus griseus GN=HYOU1 PE=2 SV=1 83 923 2.0E-87
sp|Q9JKR6|HYOU1_MOUSE Hypoxia up-regulated protein 1 OS=Mus musculus GN=Hyou1 PE=1 SV=1 83 923 2.0E-86
sp|Q9Y4L1|HYOU1_HUMAN Hypoxia up-regulated protein 1 OS=Homo sapiens GN=HYOU1 PE=1 SV=1 113 923 2.0E-85
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7ZUW2|HYOU1_DANRE Hypoxia up-regulated protein 1 OS=Danio rerio GN=hyou1 PE=2 SV=1 113 923 6.0E-95
sp|Q63617|HYOU1_RAT Hypoxia up-regulated protein 1 OS=Rattus norvegicus GN=Hyou1 PE=1 SV=1 83 923 7.0E-88
sp|Q60432|HYOU1_CRIGR Hypoxia up-regulated protein 1 OS=Cricetulus griseus GN=HYOU1 PE=2 SV=1 83 923 2.0E-87
sp|Q9JKR6|HYOU1_MOUSE Hypoxia up-regulated protein 1 OS=Mus musculus GN=Hyou1 PE=1 SV=1 83 923 2.0E-86
sp|Q9Y4L1|HYOU1_HUMAN Hypoxia up-regulated protein 1 OS=Homo sapiens GN=HYOU1 PE=1 SV=1 113 923 2.0E-85
sp|Q10061|LHS1_SCHPO Heat shock protein 70 homolog lhs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1F5.06 PE=3 SV=1 91 675 5.0E-80
sp|Q566I3|HYOU1_XENLA Hypoxia up-regulated protein 1 (Fragment) OS=Xenopus laevis GN=hyou1 PE=1 SV=2 91 557 5.0E-79
sp|Q0VA61|HYOU1_XENTR Hypoxia up-regulated protein 1 (Fragment) OS=Xenopus tropicalis GN=hyou1 PE=2 SV=2 90 557 5.0E-77
sp|Q5ZLK7|HYOU1_CHICK Hypoxia up-regulated protein 1 OS=Gallus gallus GN=HYOU1 PE=2 SV=1 83 557 4.0E-73
sp|F4JMJ1|HSP7R_ARATH Heat shock 70 kDa protein 17 OS=Arabidopsis thaliana GN=HSP70-17 PE=2 SV=1 113 919 9.0E-67
sp|P36016|LHS1_YEAST Heat shock protein 70 homolog LHS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LHS1 PE=1 SV=1 90 544 2.0E-56
sp|Q556U6|BIP1_DICDI Luminal-binding protein 1 OS=Dictyostelium discoideum GN=bip1-1 PE=3 SV=1 96 546 6.0E-52
sp|Q6FU50|LHS1_CANGA Heat shock protein 70 homolog LHS1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LHS1 PE=3 SV=1 102 673 5.0E-50
sp|Q0IIM3|HS105_BOVIN Heat shock protein 105 kDa OS=Bos taurus GN=HSPH1 PE=2 SV=1 113 935 7.0E-49
sp|Q94738|HSP97_STRFN 97 kDa heat shock protein OS=Strongylocentrotus franciscanus GN=HSP110 PE=2 SV=1 210 945 4.0E-42
sp|Q27031|HSP70_THEPA Heat shock 70 kDa protein OS=Theileria parva GN=TP02_0148 PE=2 SV=2 110 534 2.0E-37
sp|P16019|HSP70_THEAN Heat shock 70 kDa protein OS=Theileria annulata GN=TA11610 PE=3 SV=2 110 534 5.0E-37
sp|O88600|HSP74_RAT Heat shock 70 kDa protein 4 OS=Rattus norvegicus GN=Hspa4 PE=1 SV=1 113 554 2.0E-36
sp|Q61316|HSP74_MOUSE Heat shock 70 kDa protein 4 OS=Mus musculus GN=Hspa4 PE=1 SV=1 113 554 7.0E-36
sp|P34932|HSP74_HUMAN Heat shock 70 kDa protein 4 OS=Homo sapiens GN=HSPA4 PE=1 SV=4 113 554 2.0E-35
sp|Q5RDM4|HSP74_PONAB Heat shock 70 kDa protein 4 OS=Pongo abelii GN=HSPA4 PE=2 SV=1 113 554 4.0E-35
sp|Q2TFN9|HSP74_CANLF Heat shock 70 kDa protein 4 OS=Canis lupus familiaris GN=HSPA4 PE=1 SV=1 113 554 1.0E-34
sp|P49118|BIP_SOLLC Luminal-binding protein OS=Solanum lycopersicum PE=2 SV=1 83 534 7.0E-34
sp|P48722|HS74L_MOUSE Heat shock 70 kDa protein 4L OS=Mus musculus GN=Hspa4l PE=1 SV=2 189 555 1.0E-33
sp|Q03684|BIP4_TOBAC Luminal-binding protein 4 OS=Nicotiana tabacum GN=BIP4 PE=2 SV=1 93 534 1.0E-33
sp|O95757|HS74L_HUMAN Heat shock 70 kDa protein 4L OS=Homo sapiens GN=HSPA4L PE=1 SV=3 189 555 2.0E-33
sp|Q5R606|HS105_PONAB Heat shock protein 105 kDa OS=Pongo abelii GN=HSPH1 PE=2 SV=1 113 560 3.0E-33
sp|Q92598|HS105_HUMAN Heat shock protein 105 kDa OS=Homo sapiens GN=HSPH1 PE=1 SV=1 113 560 3.0E-33
sp|Q42434|BIP_SPIOL Luminal-binding protein OS=Spinacia oleracea GN=HSC70 PE=2 SV=1 95 534 5.0E-33
sp|Q61699|HS105_MOUSE Heat shock protein 105 kDa OS=Mus musculus GN=Hsph1 PE=1 SV=2 234 560 5.0E-33
sp|Q66HA8|HS105_RAT Heat shock protein 105 kDa OS=Rattus norvegicus GN=Hsph1 PE=1 SV=1 113 560 5.0E-33
sp|Q60446|HS105_CRIGR Heat shock protein 105 kDa OS=Cricetulus griseus GN=HSPH1 PE=2 SV=1 113 560 7.0E-33
sp|P78695|GRP78_NEUCR 78 kDa glucose-regulated protein homolog OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=grp78 PE=3 SV=3 88 567 8.0E-33
sp|Q6FW50|GRP78_CANGA 78 kDa glucose-regulated protein homolog OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=KAR2 PE=3 SV=1 88 567 2.0E-32
sp|O97125|HSP68_DROME Heat shock protein 68 OS=Drosophila melanogaster GN=Hsp68 PE=1 SV=1 115 614 3.0E-32
sp|Q03685|BIP5_TOBAC Luminal-binding protein 5 OS=Nicotiana tabacum GN=BIP5 PE=2 SV=1 95 534 4.0E-32
sp|Q99170|GRP78_YARLI 78 kDa glucose-regulated protein homolog OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=KAR2 PE=3 SV=1 83 567 1.0E-31
sp|Q06248|HSP74_PARLI Heat shock 70 kDa protein IV OS=Paracentrotus lividus GN=HSP70IV PE=3 SV=1 111 554 1.0E-31
sp|Q01233|HSP70_NEUCR Heat shock 70 kDa protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=hsps-1 PE=2 SV=2 115 534 1.0E-31
sp|Q91233|HSP70_ONCTS Heat shock 70 kDa protein OS=Oncorhynchus tshawytscha GN=hsp70 PE=2 SV=1 112 534 1.0E-31
sp|P41797|HSP71_CANAL Heat shock protein SSA1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SSA1 PE=1 SV=2 115 534 2.0E-31
sp|P09446|HSP7A_CAEEL Heat shock 70 kDa protein A OS=Caenorhabditis elegans GN=hsp-1 PE=1 SV=2 115 534 2.0E-31
sp|Q9LKR3|MD37A_ARATH Mediator of RNA polymerase II transcription subunit 37a OS=Arabidopsis thaliana GN=MED37A PE=1 SV=1 95 534 2.0E-31
sp|Q5NVM9|HSP7C_PONAB Heat shock cognate 71 kDa protein OS=Pongo abelii GN=HSPA8 PE=2 SV=2 112 614 2.0E-31
sp|Q71U34|HSP7C_SAGOE Heat shock cognate 71 kDa protein OS=Saguinus oedipus GN=HSPA8 PE=2 SV=1 112 614 2.0E-31
sp|P63018|HSP7C_RAT Heat shock cognate 71 kDa protein OS=Rattus norvegicus GN=Hspa8 PE=1 SV=1 112 614 2.0E-31
sp|P63017|HSP7C_MOUSE Heat shock cognate 71 kDa protein OS=Mus musculus GN=Hspa8 PE=1 SV=1 112 614 2.0E-31
sp|P11142|HSP7C_HUMAN Heat shock cognate 71 kDa protein OS=Homo sapiens GN=HSPA8 PE=1 SV=1 112 614 2.0E-31
sp|A2Q0Z1|HSP7C_HORSE Heat shock cognate 71 kDa protein OS=Equus caballus GN=HSPA8 PE=2 SV=1 112 614 2.0E-31
sp|P19120|HSP7C_BOVIN Heat shock cognate 71 kDa protein OS=Bos taurus GN=HSPA8 PE=1 SV=2 112 614 2.0E-31
sp|Q6TMK3|HSP88_DICDI Heat shock protein 88 OS=Dictyostelium discoideum GN=hspH PE=1 SV=1 114 578 3.0E-31
sp|O74225|HSP88_NEUCR Heat shock protein hsp88 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=hsp88 PE=1 SV=1 237 555 4.0E-31
sp|P55063|HS71L_RAT Heat shock 70 kDa protein 1-like OS=Rattus norvegicus GN=Hspa1l PE=2 SV=2 112 614 4.0E-31
sp|P09435|HSP73_YEAST Heat shock protein SSA3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSA3 PE=1 SV=3 115 534 4.0E-31
sp|P22010|GRP78_KLULA 78 kDa glucose-regulated protein homolog OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GRP78 PE=3 SV=1 112 619 5.0E-31
sp|P02827|HSP70_XENLA Heat shock 70 kDa protein OS=Xenopus laevis PE=2 SV=1 112 533 5.0E-31
sp|Q75C78|GRP78_ASHGO 78 kDa glucose-regulated protein homolog OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=KAR2 PE=3 SV=1 112 567 5.0E-31
sp|Q90593|GRP78_CHICK 78 kDa glucose-regulated protein OS=Gallus gallus GN=HSPA5 PE=1 SV=1 111 534 8.0E-31
sp|P24067|BIP2_MAIZE Luminal-binding protein 2 OS=Zea mays GN=BIPE2 PE=1 SV=3 112 534 8.0E-31
sp|O24581|BIP3_MAIZE Luminal-binding protein 3 OS=Zea mays GN=BIPE3 PE=2 SV=1 112 534 8.0E-31
sp|P11146|HSP7B_DROME Heat shock 70 kDa protein cognate 2 OS=Drosophila melanogaster GN=Hsc70-2 PE=1 SV=2 115 614 9.0E-31
sp|P16627|HS71L_MOUSE Heat shock 70 kDa protein 1-like OS=Mus musculus GN=Hspa1l PE=1 SV=4 112 614 1.0E-30
sp|Q9W6Y1|HSP7C_ORYLA Heat shock cognate 71 kDa protein OS=Oryzias latipes GN=hsc70 PE=2 SV=1 112 636 1.0E-30
sp|Q91883|GRP78_XENLA 78 kDa glucose-regulated protein OS=Xenopus laevis GN=hspa5 PE=2 SV=1 112 534 1.0E-30
sp|Q3S4T7|GRP78_ICTTR 78 kDa glucose-regulated protein OS=Ictidomys tridecemlineatus GN=HSPA5 PE=2 SV=1 111 534 1.0E-30
sp|Q39043|MD37F_ARATH Mediator of RNA polymerase II transcription subunit 37f OS=Arabidopsis thaliana GN=MED37F PE=1 SV=2 112 534 1.0E-30
sp|P11021|GRP78_HUMAN 78 kDa glucose-regulated protein OS=Homo sapiens GN=HSPA5 PE=1 SV=2 111 534 1.0E-30
sp|Q9VG58|HSP74_DROME Major heat shock 70 kDa protein Bbb OS=Drosophila melanogaster GN=Hsp70Bbb PE=3 SV=2 115 614 1.0E-30
sp|O73885|HSP7C_CHICK Heat shock cognate 71 kDa protein OS=Gallus gallus GN=HSPA8 PE=1 SV=1 112 614 1.0E-30
sp|P08108|HSP70_ONCMY Heat shock cognate 70 kDa protein OS=Oncorhynchus mykiss GN=hsc71 PE=2 SV=2 112 614 1.0E-30
sp|Q0VCX2|GRP78_BOVIN 78 kDa glucose-regulated protein OS=Bos taurus GN=HSPA5 PE=2 SV=1 111 534 1.0E-30
sp|P19378|HSP7C_CRIGR Heat shock cognate 71 kDa protein OS=Cricetulus griseus GN=HSPA8 PE=2 SV=1 112 614 2.0E-30
sp|Q9BIR7|HSP75_DROME Major heat shock 70 kDa protein Bc OS=Drosophila melanogaster GN=Hsp70Bc PE=2 SV=2 115 614 2.0E-30
sp|Q9BIS2|HSP73_DROME Major heat shock 70 kDa protein Bb OS=Drosophila melanogaster GN=Hsp70Bb PE=2 SV=2 115 614 2.0E-30
sp|Q8INI8|HSP72_DROME Major heat shock 70 kDa protein Ba OS=Drosophila melanogaster GN=Hsp70Ba PE=2 SV=2 115 614 2.0E-30
sp|Q04967|HSP76_PIG Heat shock 70 kDa protein 6 OS=Sus scrofa GN=HSPA6 PE=2 SV=1 115 614 2.0E-30
sp|P22202|HSP74_YEAST Heat shock protein SSA4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSA4 PE=1 SV=3 115 534 2.0E-30
sp|P02825|HSP71_DROME Major heat shock 70 kDa protein Ab OS=Drosophila melanogaster GN=Hsp70Ab PE=2 SV=3 115 614 2.0E-30
sp|P82910|HSP70_DROME Major heat shock 70 kDa protein Aa OS=Drosophila melanogaster GN=Hsp70Aa PE=2 SV=2 115 614 2.0E-30
sp|Q4R888|HS71L_MACFA Heat shock 70 kDa protein 1-like OS=Macaca fascicularis GN=HSPA1L PE=2 SV=1 112 533 3.0E-30
sp|P14834|HSP70_LEIMA Heat shock 70 kDa protein (Fragment) OS=Leishmania major GN=HSP70 PE=3 SV=1 115 534 3.0E-30
sp|P16474|GRP78_YEAST 78 kDa glucose-regulated protein homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KAR2 PE=1 SV=1 112 567 3.0E-30
sp|P17066|HSP76_HUMAN Heat shock 70 kDa protein 6 OS=Homo sapiens GN=HSPA6 PE=1 SV=2 115 598 3.0E-30
sp|P10591|HSP71_YEAST Heat shock protein SSA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSA1 PE=1 SV=4 115 534 4.0E-30
sp|P06761|GRP78_RAT 78 kDa glucose-regulated protein OS=Rattus norvegicus GN=Hspa5 PE=1 SV=1 111 534 4.0E-30
sp|P53421|HSP71_PICAN Heat shock protein 70 1 OS=Pichia angusta GN=HSA1 PE=1 SV=2 115 534 4.0E-30
sp|P07823|GRP78_MESAU 78 kDa glucose-regulated protein OS=Mesocricetus auratus GN=HSPA5 PE=1 SV=1 111 534 4.0E-30
sp|Q9GSU4|HSP72_DROSI Major heat shock 70 kDa protein Ba OS=Drosophila simulans GN=Hsp70Ba PE=3 SV=2 115 614 4.0E-30
sp|Q5R4P0|GRP78_PONAB 78 kDa glucose-regulated protein OS=Pongo abelii GN=HSPA5 PE=2 SV=1 111 534 4.0E-30
sp|P20029|GRP78_MOUSE 78 kDa glucose-regulated protein OS=Mus musculus GN=Hspa5 PE=1 SV=3 111 534 4.0E-30
sp|Q05746|HSP70_PLACB Heat shock 70 kDa protein OS=Plasmodium cynomolgi (strain Berok) PE=2 SV=1 115 534 4.0E-30
sp|P11144|HSP70_PLAFA Heat shock 70 kDa protein OS=Plasmodium falciparum PE=2 SV=2 115 534 5.0E-30
sp|P34931|HS71L_HUMAN Heat shock 70 kDa protein 1-like OS=Homo sapiens GN=HSPA1L PE=1 SV=2 112 533 6.0E-30
sp|Q9HG01|GRP78_PICAN 78 kDa glucose-regulated protein homolog OS=Pichia angusta GN=BiP PE=3 SV=1 112 567 6.0E-30
sp|Q9GSU7|HSP71_DROSI Major heat shock 70 kDa protein Ab OS=Drosophila simulans GN=Hsp70Ab PE=3 SV=2 115 614 6.0E-30
sp|P0CB32|HS71L_BOVIN Heat shock 70 kDa protein 1-like OS=Bos taurus GN=HSPA1L PE=3 SV=1 112 614 6.0E-30
sp|A5A8V7|HS71L_PIG Heat shock 70 kDa protein 1-like OS=Sus scrofa GN=HSPA1L PE=2 SV=1 112 614 8.0E-30
sp|P10592|HSP72_YEAST Heat shock protein SSA2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSA2 PE=1 SV=3 115 534 9.0E-30
sp|Q7YQC6|HSP71_CANLF Heat shock 70 kDa protein 1 OS=Canis lupus familiaris GN=HSPA1 PE=2 SV=1 113 533 1.0E-29
sp|Q00043|HSP70_AJECA Heat shock 70 kDa protein OS=Ajellomyces capsulatus GN=HSP70 PE=3 SV=1 115 534 1.0E-29
sp|Q5R7D3|HSP71_PONAB Heat shock 70 kDa protein 1 OS=Pongo abelii GN=HSPA1 PE=2 SV=1 113 533 1.0E-29
sp|P0DMV9|HS71B_HUMAN Heat shock 70 kDa protein 1B OS=Homo sapiens GN=HSPA1B PE=1 SV=1 113 533 1.0E-29
sp|P0DMV8|HS71A_HUMAN Heat shock 70 kDa protein 1A OS=Homo sapiens GN=HSPA1A PE=1 SV=1 113 533 1.0E-29
sp|P41753|HSP70_ACHKL Heat shock 70 kDa protein OS=Achlya klebsiana GN=HSP70 PE=2 SV=1 109 636 1.0E-29
sp|Q9C7X7|HSP7N_ARATH Heat shock 70 kDa protein 18 OS=Arabidopsis thaliana GN=HSP70-18 PE=2 SV=1 112 534 1.0E-29
sp|O59855|HSP72_SCHPO Probable heat shock protein ssa2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ssa2 PE=1 SV=3 115 534 1.0E-29
sp|Q24895|GRP78_ECHMU 78 kDa glucose-regulated protein OS=Echinococcus multilocularis GN=GRP78 PE=2 SV=1 98 534 2.0E-29
sp|P24629|HSP71_SOLLC Heat shock cognate 70 kDa protein 1 OS=Solanum lycopersicum GN=HSC-I PE=2 SV=1 112 534 2.0E-29
sp|P27541|HSP70_BRUMA Heat shock 70 kDa protein OS=Brugia malayi GN=HSP70 PE=3 SV=1 115 534 2.0E-29
sp|P46587|HSP72_CANAL Heat shock protein SSA2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SSA2 PE=1 SV=3 115 534 2.0E-29
sp|Q8H1B3|MD37B_ARATH Probable mediator of RNA polymerase II transcription subunit 37b OS=Arabidopsis thaliana GN=MED37B PE=1 SV=1 112 534 2.0E-29
sp|Q9N1U2|HSP76_SAGOE Heat shock 70 kDa protein 6 OS=Saguinus oedipus GN=HSPA6 PE=2 SV=1 115 598 2.0E-29
sp|O93866|HSP70_TRIRU Heat shock 70 kDa protein OS=Trichophyton rubrum GN=HSP70 PE=2 SV=1 115 534 2.0E-29
sp|Q24798|GRP78_ECHGR 78 kDa glucose-regulated protein OS=Echinococcus granulosus GN=GRP78 PE=2 SV=1 98 534 2.0E-29
sp|P08106|HSP70_CHICK Heat shock 70 kDa protein OS=Gallus gallus PE=1 SV=1 112 614 2.0E-29
sp|Q90473|HSP7C_DANRE Heat shock cognate 71 kDa protein OS=Danio rerio GN=hspa8 PE=2 SV=1 112 614 2.0E-29
sp|P09189|HSP7C_PETHY Heat shock cognate 70 kDa protein OS=Petunia hybrida GN=HSP70 PE=2 SV=1 112 534 3.0E-29
sp|P83616|GRP78_ASPNG 78 kDa glucose-regulated protein homolog OS=Aspergillus niger GN=bipA PE=2 SV=1 90 534 3.0E-29
sp|P83617|GRP78_ASPKA 78 kDa glucose-regulated protein homolog OS=Aspergillus kawachii GN=bipA PE=3 SV=1 90 534 3.0E-29
sp|P59769|GRP78_ASPAW 78 kDa glucose-regulated protein homolog OS=Aspergillus awamori GN=bipA PE=2 SV=1 90 534 3.0E-29
sp|Q16956|GRP78_APLCA 78 kDa glucose-regulated protein OS=Aplysia californica PE=1 SV=1 89 534 3.0E-29
sp|Q4U0F3|HS71B_BOSMU Heat shock 70 kDa protein 1B OS=Bos mutus grunniens GN=HSPA1B PE=2 SV=1 115 533 3.0E-29
sp|P26413|HSP70_SOYBN Heat shock 70 kDa protein OS=Glycine max GN=HSP70 PE=3 SV=1 112 534 3.0E-29
sp|Q6BZH1|GRP78_DEBHA 78 kDa glucose-regulated protein homolog OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=KAR2 PE=3 SV=1 112 567 4.0E-29
sp|Q27975|HS71A_BOVIN Heat shock 70 kDa protein 1A OS=Bos taurus GN=HSPA1A PE=1 SV=2 115 533 4.0E-29
sp|P22953|MD37E_ARATH Probable mediator of RNA polymerase II transcription subunit 37e OS=Arabidopsis thaliana GN=MED37E PE=1 SV=3 106 534 4.0E-29
sp|Q27965|HS71B_BOVIN Heat shock 70 kDa protein 1B OS=Bos taurus GN=HSPA1B PE=2 SV=1 115 533 4.0E-29
sp|Q6S4N2|HS71B_PIG Heat shock 70 kDa protein 1B OS=Sus scrofa GN=HSPA1B PE=2 SV=1 115 533 4.0E-29
sp|O59838|HSP7F_SCHPO Heat shock protein homolog pss1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pss1 PE=1 SV=2 114 555 6.0E-29
sp|P29843|HSP7A_DROME Heat shock 70 kDa protein cognate 1 OS=Drosophila melanogaster GN=Hsc70-1 PE=1 SV=1 115 533 6.0E-29
sp|P17804|HSP70_LEIDO Heat shock 70 kDa protein OS=Leishmania donovani GN=HSP70 PE=3 SV=1 115 534 6.0E-29
sp|P91902|HSP70_CERCA Heat shock protein 70 OS=Ceratitis capitata PE=2 SV=1 115 534 7.0E-29
sp|P08418|HSP70_SCHMA Heat shock 70 kDa protein homolog OS=Schistosoma mansoni PE=2 SV=2 115 534 8.0E-29
sp|P18694|HSP72_USTMA Heat shock 70 kDa protein 2 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMS2 PE=3 SV=2 115 534 8.0E-29
sp|P54652|HSP72_HUMAN Heat shock-related 70 kDa protein 2 OS=Homo sapiens GN=HSPA2 PE=1 SV=1 112 614 9.0E-29
sp|Q96W30|HSP72_PARBA Heat shock 70 kDa protein 2 OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=HSP70-2 PE=2 SV=2 115 534 9.0E-29
sp|P25840|HSP70_CHLRE Heat shock 70 kDa protein OS=Chlamydomonas reinhardtii GN=HSP70 PE=2 SV=2 115 534 1.0E-28
sp|Q9I8F9|HSP71_ORYLA Heat shock 70 kDa protein 1 OS=Oryzias latipes PE=3 SV=1 115 534 1.0E-28
sp|P29844|HSP7C_DROME Heat shock 70 kDa protein cognate 3 OS=Drosophila melanogaster GN=Hsc70-3 PE=2 SV=2 112 534 2.0E-28
sp|Q9U639|HSP7D_MANSE Heat shock 70 kDa protein cognate 4 OS=Manduca sexta PE=2 SV=1 115 533 2.0E-28
sp|P0DMW1|HS71B_RAT Heat shock 70 kDa protein 1B OS=Rattus norvegicus GN=Hspa1a PE=2 SV=1 115 533 2.0E-28
sp|P0DMW0|HS71A_RAT Heat shock 70 kDa protein 1A OS=Rattus norvegicus GN=Hspa1a PE=2 SV=1 115 533 2.0E-28
sp|Q24789|HSP70_ECHGR Heat shock cognate 70 kDa protein OS=Echinococcus granulosus GN=HSP70 PE=2 SV=1 112 534 2.0E-28
sp|P41826|HSP72_ANOAL Heat shock protein 70 A2 OS=Anopheles albimanus GN=HSP70A2 PE=3 SV=1 113 534 2.0E-28
sp|P41825|HSP71_ANOAL Heat shock protein 70 A1 OS=Anopheles albimanus GN=HSP70A1 PE=3 SV=1 113 534 3.0E-28
sp|Q9TUG3|HSP72_CAPHI Heat shock-related 70 kDa protein 2 OS=Capra hircus GN=HSPA2 PE=3 SV=1 112 614 3.0E-28
sp|P53623|HSP72_PICAN Heat shock protein 70 2 OS=Pichia angusta GN=HSA2 PE=3 SV=2 115 534 3.0E-28
sp|P14659|HSP72_RAT Heat shock-related 70 kDa protein 2 OS=Rattus norvegicus GN=Hspa2 PE=1 SV=2 112 614 3.0E-28
sp|P17156|HSP72_MOUSE Heat shock-related 70 kDa protein 2 OS=Mus musculus GN=Hspa2 PE=1 SV=2 112 614 3.0E-28
sp|Q5B2V1|HSP70_EMENI Heat shock 70 kDa protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=hsp70 PE=1 SV=1 115 534 3.0E-28
sp|Q10265|HSP71_SCHPO Probable heat shock protein ssa1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ssa1 PE=1 SV=2 115 533 3.0E-28
sp|P27322|HSP72_SOLLC Heat shock cognate 70 kDa protein 2 OS=Solanum lycopersicum GN=HSC-2 PE=2 SV=1 112 534 3.0E-28
sp|P17879|HS71B_MOUSE Heat shock 70 kDa protein 1B OS=Mus musculus GN=Hspa1b PE=1 SV=3 115 533 4.0E-28
sp|Q61696|HS71A_MOUSE Heat shock 70 kDa protein 1A OS=Mus musculus GN=Hspa1a PE=1 SV=2 115 533 4.0E-28
sp|P34933|HSP72_BOVIN Heat shock-related 70 kDa protein 2 OS=Bos taurus GN=HSPA2 PE=2 SV=2 112 614 4.0E-28
sp|Q9LHA8|MD37C_ARATH Probable mediator of RNA polymerase II transcription subunit 37c OS=Arabidopsis thaliana GN=MED37C PE=1 SV=1 112 534 4.0E-28
sp|O65719|HSP7C_ARATH Heat shock 70 kDa protein 3 OS=Arabidopsis thaliana GN=HSP70-3 PE=1 SV=1 112 534 5.0E-28
sp|P41827|HSP74_ANOAL Heat shock protein 70 B2 OS=Anopheles albimanus GN=HSP70B2 PE=3 SV=1 113 534 6.0E-28
sp|P32589|HSP7F_YEAST Heat shock protein homolog SSE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSE1 PE=1 SV=4 115 555 9.0E-28
sp|P29357|HSP7E_SPIOL Chloroplast envelope membrane 70 kDa heat shock-related protein OS=Spinacia oleracea GN=SCE70 PE=1 SV=3 112 534 9.0E-28
sp|P22954|MD37D_ARATH Probable mediator of RNA polymerase II transcription subunit 37c OS=Arabidopsis thaliana GN=MED37D PE=1 SV=2 112 534 1.0E-27
sp|Q9SAB1|HSP7Q_ARATH Heat shock 70 kDa protein 16 OS=Arabidopsis thaliana GN=HSP70-16 PE=2 SV=1 113 561 1.0E-27
sp|P20163|HSP7D_CAEEL Heat shock 70 kDa protein D OS=Caenorhabditis elegans GN=hsp-4 PE=1 SV=2 112 531 1.0E-27
sp|P34930|HS71A_PIG Heat shock 70 kDa protein 1A OS=Sus scrofa GN=HSPA1A PE=3 SV=1 115 533 1.0E-27
sp|Q75E44|HSP75_ASHGO Heat shock protein SSB OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SSB PE=3 SV=3 109 536 1.0E-27
sp|P11147|HSP7D_DROME Heat shock 70 kDa protein cognate 4 OS=Drosophila melanogaster GN=Hsc70-4 PE=1 SV=3 115 533 2.0E-27
sp|P36604|GRP78_SCHPO 78 kDa glucose-regulated protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bip1 PE=3 SV=2 112 534 2.0E-27
sp|P87222|HSP75_CANAW Heat shock protein SSB1 OS=Candida albicans (strain WO-1) GN=SSB1 PE=3 SV=2 109 534 2.0E-27
sp|P32590|HSP79_YEAST Heat shock protein homolog SSE2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSE2 PE=1 SV=3 115 573 2.0E-27
sp|Q01100|DNAK_HALMA Chaperone protein DnaK OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=dnaK PE=3 SV=2 114 534 2.0E-27
sp|P37899|HSP70_PYRSA Heat shock 70 kDa protein OS=Pyrenomonas salina GN=HSP70 PE=3 SV=1 110 534 2.0E-27
sp|P47773|HSP7C_ICTPU Heat shock cognate 71 kDa protein OS=Ictalurus punctatus GN=hsc70 PE=2 SV=1 112 530 2.0E-27
sp|Q05036|YLA4_CAEEL Uncharacterized protein C30C11.4 OS=Caenorhabditis elegans GN=C30C11.4 PE=3 SV=1 113 577 3.0E-27
sp|P36415|HS7C1_DICDI Heat shock cognate 70 kDa protein 1 OS=Dictyostelium discoideum GN=hspB PE=1 SV=2 115 534 3.0E-27
sp|P40918|HSP70_DAVTA Heat shock 70 kDa protein OS=Davidiella tassiana GN=HSP70 PE=1 SV=1 115 534 4.0E-27
sp|Q91291|HSP70_PLEWA Heat shock 70 kDa protein OS=Pleurodeles waltl GN=HSP70 PE=2 SV=1 112 533 4.0E-27
sp|Q54BE0|HS7C3_DICDI Heat shock cognate 70 kDa protein 3 OS=Dictyostelium discoideum GN=DDB_G0293674 PE=3 SV=1 115 614 4.0E-27
sp|Q07437|HSP70_LEIAM Heat shock 70 kDa protein OS=Leishmania amazonensis GN=HSP70 PE=2 SV=1 115 534 4.0E-27
sp|Q875V0|HSP7F_NAUCC Heat shock protein homolog SSE1 OS=Naumovozyma castellii (strain ATCC 76901 / CBS 4309 / NBRC 1992 / NRRL Y-12630) GN=SSE1 PE=3 SV=1 115 555 5.0E-27
sp|P11143|HSP70_MAIZE Heat shock 70 kDa protein OS=Zea mays GN=HSP70 PE=3 SV=2 112 534 6.0E-27
sp|P11484|HSP75_YEAST Heat shock protein SSB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSB1 PE=1 SV=3 109 534 6.0E-27
sp|Q6FJI3|HSP7F_CANGA Heat shock protein homolog SSE1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SSE1 PE=3 SV=1 115 552 6.0E-27
sp|Q10284|HSP75_SCHPO Heat shock protein sks2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sks2 PE=1 SV=2 115 534 7.0E-27
sp|Q9S9N1|HSP7E_ARATH Heat shock 70 kDa protein 5 OS=Arabidopsis thaliana GN=HSP70-5 PE=2 SV=1 115 613 7.0E-27
sp|P40150|HSP76_YEAST Heat shock protein SSB2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSB2 PE=1 SV=2 109 534 8.0E-27
sp|Q557E0|HS7C2_DICDI Heat shock cognate 70 kDa protein 2 OS=Dictyostelium discoideum GN=hspE-1 PE=1 SV=1 115 615 1.0E-26
sp|Q05866|GRP78_PLAFO 78 kDa glucose-regulated protein homolog OS=Plasmodium falciparum (isolate NF54) PE=3 SV=1 88 531 2.0E-26
sp|Q707X3|HSP75_ZYGRC Heat shock protein SSB OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=SSB PE=3 SV=3 109 534 2.0E-26
sp|P27420|HSP7C_CAEEL Heat shock 70 kDa protein C OS=Caenorhabditis elegans GN=hsp-3 PE=3 SV=2 112 534 3.0E-26
sp|Q05944|HSP70_HYDVU Heat shock 70 kDa protein OS=Hydra vulgaris GN=HSP70.1 PE=3 SV=1 115 534 3.0E-26
sp|P48720|HSP70_BLAEM Heat shock 70 kDa protein OS=Blastocladiella emersonii GN=HSP70 PE=3 SV=1 115 614 3.0E-26
sp|P11145|HSP74_TRYBB Heat shock 70 kDa protein 4 OS=Trypanosoma brucei brucei PE=2 SV=2 115 534 4.0E-26
sp|Q707W3|HSP75_KLUDE Heat shock protein SSB OS=Kluyveromyces delphensis GN=SSB PE=3 SV=3 109 534 5.0E-26
sp|P41770|HSP75_KLUMA Heat shock protein SSB OS=Kluyveromyces marxianus GN=SSB PE=3 SV=2 109 534 6.0E-26
sp|P19208|HSP7C_CAEBR Heat shock 70 kDa protein C OS=Caenorhabditis briggsae GN=hsp-3 PE=3 SV=2 112 534 6.0E-26
sp|Q28222|HSP71_CHLAE Heat shock 70 kDa protein 1 OS=Chlorocebus aethiops GN=HSPA1 PE=2 SV=1 113 533 9.0E-26
sp|B9KCH0|DNAK_CAMLR Chaperone protein DnaK OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=dnaK PE=3 SV=1 114 613 1.0E-25
sp|A7GXU4|DNAK_CAMC5 Chaperone protein DnaK OS=Campylobacter curvus (strain 525.92) GN=dnaK PE=3 SV=1 114 613 2.0E-25
sp|B9L8Z0|DNAK_NAUPA Chaperone protein DnaK OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=dnaK PE=3 SV=1 112 533 2.0E-25
sp|Q876N3|HSP75_CANGA Heat shock protein SSB OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SSB1 PE=3 SV=3 109 534 2.0E-25
sp|P26791|HSP70_DAUCA Heat shock 70 kDa protein OS=Daucus carota GN=HSP70 PE=3 SV=1 111 534 2.0E-25
sp|P05456|HSP70_TRYCR Heat shock 70 kDa protein OS=Trypanosoma cruzi GN=HSP70 PE=3 SV=1 115 534 4.0E-25
sp|P16394|HSP70_BRELC Heat shock 70 kDa protein OS=Bremia lactucae GN=HSP70 PE=3 SV=1 110 534 4.0E-25
sp|A7ZEB5|DNAK_CAMC1 Chaperone protein DnaK OS=Campylobacter concisus (strain 13826) GN=dnaK PE=3 SV=1 114 531 4.0E-25
sp|Q8T869|BIP2_DICDI Luminal-binding protein 2 OS=Dictyostelium discoideum GN=bip2 PE=1 SV=1 112 531 1.0E-24
sp|Q01877|HSP71_PUCGR Heat shock protein HSS1 OS=Puccinia graminis GN=HSS1 PE=3 SV=1 115 534 1.0E-24
sp|Q875P5|HSP7F_LACK1 Heat shock protein homolog SSE1 OS=Lachancea kluyveri (strain ATCC 58438 / CBS 3082 / CCRC 21498 / NBRC 1685 / JCM 7257 / NCYC 543 / NRRL Y-12651) GN=SSE1 PE=3 SV=1 115 555 1.0E-24
sp|B2URT8|DNAK_HELPS Chaperone protein DnaK OS=Helicobacter pylori (strain Shi470) GN=dnaK PE=3 SV=1 112 533 2.0E-24
sp|P55994|DNAK_HELPY Chaperone protein DnaK OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=dnaK PE=3 SV=2 112 533 2.0E-24
sp|O69298|DNAK_CAMJE Chaperone protein DnaK OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=dnaK PE=3 SV=1 114 613 2.0E-24
sp|A7H484|DNAK_CAMJD Chaperone protein DnaK OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=dnaK PE=3 SV=1 114 613 2.0E-24
sp|A5EYG3|DNAK_DICNV Chaperone protein DnaK OS=Dichelobacter nodosus (strain VCS1703A) GN=dnaK PE=3 SV=1 112 554 3.0E-24
sp|Q96VB9|HSP7F_CANAL Heat shock protein homolog SSE1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MSI3 PE=1 SV=2 115 552 3.0E-24
sp|P87047|HSP71_PARBA Heat shock 70 kDa protein 1 OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=HSP70-1 PE=1 SV=1 115 534 3.0E-24
sp|Q6CQ83|HSP75_KLULA Heat shock protein SSB OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SSB PE=3 SV=3 109 534 3.0E-24
sp|Q5HV33|DNAK_CAMJR Chaperone protein DnaK OS=Campylobacter jejuni (strain RM1221) GN=dnaK PE=3 SV=1 114 613 3.0E-24
sp|A8FLH2|DNAK_CAMJ8 Chaperone protein DnaK OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=dnaK PE=3 SV=1 114 613 3.0E-24
sp|B2KAX0|DNAK_ELUMP Chaperone protein DnaK OS=Elusimicrobium minutum (strain Pei191) GN=dnaK PE=3 SV=1 237 534 5.0E-24
sp|Q5UQ49|HSP70_MIMIV Heat shock 70 kDa protein homolog OS=Acanthamoeba polyphaga mimivirus GN=HSP70 PE=3 SV=1 115 533 6.0E-24
sp|Q39PT7|DNAK_GEOMG Chaperone protein DnaK OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=dnaK PE=3 SV=1 114 533 7.0E-24
sp|Q9ZEJ0|DNAK_MYCHO Chaperone protein DnaK OS=Mycoplasma hominis GN=dnaK PE=3 SV=1 114 534 7.0E-24
sp|B5Z9P0|DNAK_HELPG Chaperone protein DnaK OS=Helicobacter pylori (strain G27) GN=dnaK PE=3 SV=1 112 533 8.0E-24
sp|B6JPL0|DNAK_HELP2 Chaperone protein DnaK OS=Helicobacter pylori (strain P12) GN=dnaK PE=3 SV=1 112 533 8.0E-24
sp|A1ANV0|DNAK_PELPD Chaperone protein DnaK OS=Pelobacter propionicus (strain DSM 2379) GN=dnaK PE=3 SV=1 114 533 8.0E-24
sp|Q1CV46|DNAK_HELPH Chaperone protein DnaK OS=Helicobacter pylori (strain HPAG1) GN=dnaK PE=3 SV=1 112 533 9.0E-24
sp|Q6AC76|DNAK_LEIXX Chaperone protein DnaK OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=dnaK PE=3 SV=1 237 533 9.0E-24
sp|A0RPW7|DNAK_CAMFF Chaperone protein DnaK OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=dnaK PE=3 SV=1 114 613 1.0E-23
sp|B5YH59|DNAK_THEYD Chaperone protein DnaK OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=dnaK PE=3 SV=1 112 554 1.0E-23
sp|Q54BD8|HS7C4_DICDI Heat shock cognate 70 kDa protein 4 OS=Dictyostelium discoideum GN=DDB_G0293678 PE=3 SV=1 115 534 1.0E-23
sp|Q3IUI0|DNAK_NATPD Chaperone protein DnaK OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=dnaK PE=3 SV=1 114 534 2.0E-23
sp|A5GDC8|DNAK_GEOUR Chaperone protein DnaK OS=Geobacter uraniireducens (strain Rf4) GN=dnaK PE=3 SV=1 114 533 2.0E-23
sp|C6E643|DNAK_GEOSM Chaperone protein DnaK OS=Geobacter sp. (strain M21) GN=dnaK PE=3 SV=1 114 533 2.0E-23
sp|Q7MA35|DNAK_WOLSU Chaperone protein DnaK OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=dnaK PE=3 SV=1 112 533 3.0E-23
sp|P48721|GRP75_RAT Stress-70 protein, mitochondrial OS=Rattus norvegicus GN=Hspa9 PE=1 SV=3 105 534 3.0E-23
sp|Q17VY4|DNAK_HELAH Chaperone protein DnaK OS=Helicobacter acinonychis (strain Sheeba) GN=dnaK PE=3 SV=1 112 533 4.0E-23
sp|Q9ZMW4|DNAK_HELPJ Chaperone protein DnaK OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=dnaK PE=3 SV=3 112 533 4.0E-23
sp|B5EC42|DNAK_GEOBB Chaperone protein DnaK OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=dnaK PE=3 SV=1 114 533 6.0E-23
sp|Q3J7D8|DNAK_NITOC Chaperone protein DnaK OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=dnaK PE=3 SV=1 112 554 6.0E-23
sp|Q92260|HSP70_PENCI Heat shock 70 kDa protein (Fragment) OS=Penicillium citrinum GN=HSP70 PE=1 SV=1 261 534 7.0E-23
sp|Q9RY23|DNAK_DEIRA Chaperone protein DnaK OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=dnaK PE=1 SV=3 115 530 7.0E-23
sp|A9WQR3|DNAK_RENSM Chaperone protein DnaK OS=Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235) GN=dnaK PE=3 SV=1 237 533 8.0E-23
sp|P29845|HSP7E_DROME Heat shock 70 kDa protein cognate 5 OS=Drosophila melanogaster GN=Hsc70-5 PE=1 SV=2 105 534 8.0E-23
sp|P96133|DNAK_THERP Chaperone protein DnaK OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=dnaK PE=3 SV=2 112 534 1.0E-22
sp|A6WFV7|DNAK_KINRD Chaperone protein DnaK OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=dnaK PE=3 SV=1 237 533 1.0E-22
sp|Q9S7C0|HSP7O_ARATH Heat shock 70 kDa protein 14 OS=Arabidopsis thaliana GN=HSP70-14 PE=2 SV=1 113 579 1.0E-22
sp|Q04EE1|DNAK_OENOB Chaperone protein DnaK OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=dnaK PE=3 SV=1 240 534 1.0E-22
sp|B9LUC7|DNAK_HALLT Chaperone protein DnaK OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=dnaK PE=3 SV=1 114 534 1.0E-22
sp|F4HQD4|HSP7P_ARATH Heat shock 70 kDa protein 15 OS=Arabidopsis thaliana GN=HSP70-15 PE=1 SV=1 113 579 1.0E-22
sp|Q30Q10|DNAK_SULDN Chaperone protein DnaK OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=dnaK PE=3 SV=1 114 533 2.0E-22
sp|Q9HRY2|DNAK_HALSA Chaperone protein DnaK OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=dnaK PE=3 SV=1 229 534 2.0E-22
sp|B0R3H4|DNAK_HALS3 Chaperone protein DnaK OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=dnaK PE=3 SV=1 229 534 2.0E-22
sp|B3WEQ7|DNAK_LACCB Chaperone protein DnaK OS=Lactobacillus casei (strain BL23) GN=dnaK PE=3 SV=1 114 534 2.0E-22
sp|Q038N3|DNAK_LACC3 Chaperone protein DnaK OS=Lactobacillus casei (strain ATCC 334) GN=dnaK PE=3 SV=1 114 534 2.0E-22
sp|B9M357|DNAK_GEODF Chaperone protein DnaK OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=dnaK PE=3 SV=1 114 533 2.0E-22
sp|B1H009|DNAK_UNCTG Chaperone protein DnaK OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=dnaK PE=3 SV=1 237 534 2.0E-22
sp|Q4KIH1|DNAK_PSEF5 Chaperone protein DnaK OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=dnaK PE=3 SV=1 112 534 2.0E-22
sp|A4XYF6|DNAK_PSEMY Chaperone protein DnaK OS=Pseudomonas mendocina (strain ymp) GN=dnaK PE=3 SV=1 112 534 2.0E-22
sp|B0RBI1|DNAK_CLAMS Chaperone protein DnaK OS=Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1) GN=dnaK PE=3 SV=1 237 614 2.0E-22
sp|Q9LCQ5|DNAK_BRECH Chaperone protein DnaK OS=Brevibacillus choshinensis GN=dnaK PE=3 SV=1 114 534 2.0E-22
sp|C1CZH9|DNAK_DEIDV Chaperone protein DnaK OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=dnaK PE=3 SV=1 115 530 2.0E-22
sp|A5CM86|DNAK_CLAM3 Chaperone protein DnaK OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=dnaK PE=3 SV=1 237 614 3.0E-22
sp|Q3ZCH0|GRP75_BOVIN Stress-70 protein, mitochondrial OS=Bos taurus GN=HSPA9 PE=2 SV=1 100 534 3.0E-22
sp|Q9ZEJ6|DNAK1_NOSS1 Chaperone protein dnaK1 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=dnaK1 PE=3 SV=2 112 538 3.0E-22
sp|P94695|DNAK_DEIPM Chaperone protein DnaK OS=Deinococcus proteolyticus (strain ATCC 35074 / DSM 20540 / JCM 6276 / NBRC 101906 / NCIMB 13154 / VKM Ac-1939 / CCM 2703 / MRP) GN=dnaK PE=3 SV=2 115 530 3.0E-22
sp|B3E7W9|DNAK_GEOLS Chaperone protein DnaK OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=dnaK PE=3 SV=1 114 533 3.0E-22
sp|P38647|GRP75_MOUSE Stress-70 protein, mitochondrial OS=Mus musculus GN=Hspa9 PE=1 SV=3 110 534 3.0E-22
sp|O35501|GRP75_CRIGR Stress-70 protein, mitochondrial OS=Cricetulus griseus GN=HSPA9 PE=2 SV=1 110 534 3.0E-22
sp|P50022|DNAK3_SYNE7 Chaperone protein dnaK3 OS=Synechococcus elongatus (strain PCC 7942) GN=dnaK3 PE=3 SV=1 112 534 4.0E-22
sp|Q55154|DNAK1_SYNY3 Chaperone protein dnaK1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=dnaK1 PE=3 SV=1 112 531 4.0E-22
sp|P38646|GRP75_HUMAN Stress-70 protein, mitochondrial OS=Homo sapiens GN=HSPA9 PE=1 SV=2 105 534 4.0E-22
sp|A6Q421|DNAK_NITSB Chaperone protein DnaK OS=Nitratiruptor sp. (strain SB155-2) GN=dnaK PE=3 SV=1 114 531 4.0E-22
sp|Q3A8C2|DNAK_PELCD Chaperone protein DnaK OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=dnaK PE=3 SV=1 112 533 4.0E-22
sp|Q74H59|DNAK_GEOSL Chaperone protein DnaK OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=dnaK PE=3 SV=1 114 533 5.0E-22
sp|B3DZP7|DNAK_METI4 Chaperone protein DnaK OS=Methylacidiphilum infernorum (isolate V4) GN=dnaK PE=3 SV=1 114 533 5.0E-22
sp|B0K3Y0|DNAK_THEPX Chaperone protein DnaK OS=Thermoanaerobacter sp. (strain X514) GN=dnaK PE=3 SV=1 112 554 5.0E-22
sp|A5IXT5|DNAK_MYCAP Chaperone protein DnaK OS=Mycoplasma agalactiae (strain PG2) GN=dnaK PE=3 SV=1 113 534 6.0E-22
sp|B7V1H3|DNAK_PSEA8 Chaperone protein DnaK OS=Pseudomonas aeruginosa (strain LESB58) GN=dnaK PE=3 SV=1 112 554 6.0E-22
sp|A5N6M2|DNAK_CLOK5 Chaperone protein DnaK OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=dnaK PE=3 SV=1 114 570 6.0E-22
sp|B9E041|DNAK_CLOK1 Chaperone protein DnaK OS=Clostridium kluyveri (strain NBRC 12016) GN=dnaK PE=3 SV=1 114 570 6.0E-22
sp|Q6KIH7|DNAK_MYCMO Chaperone protein DnaK OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=dnaK PE=3 SV=1 198 534 6.0E-22
sp|Q9HV43|DNAK_PSEAE Chaperone protein DnaK OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=dnaK PE=3 SV=1 112 554 7.0E-22
sp|Q02FR1|DNAK_PSEAB Chaperone protein DnaK OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=dnaK PE=3 SV=1 112 554 7.0E-22
sp|B2GBQ5|DNAK_LACF3 Chaperone protein DnaK OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=dnaK PE=3 SV=1 237 534 7.0E-22
sp|A4IX28|DNAK_FRATW Chaperone protein DnaK OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=dnaK PE=3 SV=1 112 570 7.0E-22
sp|Q54MR6|HS7C5_DICDI Heat shock 70-related protein 5 OS=Dictyostelium discoideum GN=DDB_G0285709 PE=3 SV=1 114 534 7.0E-22
sp|O52960|DNAK_APHHA Chaperone protein DnaK OS=Aphanothece halophytica GN=dnaK PE=2 SV=1 112 542 7.0E-22
sp|A6VCL8|DNAK_PSEA7 Chaperone protein DnaK OS=Pseudomonas aeruginosa (strain PA7) GN=dnaK PE=3 SV=1 112 554 7.0E-22
sp|O05714|DNAK_ANAVT Chaperone protein DnaK OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=dnaK PE=3 SV=1 112 538 8.0E-22
sp|Q086J3|DNAK_SHEFN Chaperone protein DnaK OS=Shewanella frigidimarina (strain NCIMB 400) GN=dnaK PE=3 SV=1 112 570 8.0E-22
sp|B6YRF7|DNAK_AZOPC Chaperone protein DnaK OS=Azobacteroides pseudotrichonymphae genomovar. CFP2 GN=dnaK PE=3 SV=1 112 581 9.0E-22
sp|A5IDK8|DNAK_LEGPC Chaperone protein DnaK OS=Legionella pneumophila (strain Corby) GN=dnaK PE=3 SV=1 114 554 9.0E-22
sp|Q5N1V0|DNAK1_SYNP6 Chaperone protein DnaK 1 OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=dnaK1 PE=3 SV=1 112 534 9.0E-22
sp|O32482|DNAK_LEGPN Chaperone protein DnaK OS=Legionella pneumophila GN=dnaK PE=3 SV=1 114 554 1.0E-21
sp|Q5ZTY3|DNAK_LEGPH Chaperone protein DnaK OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=dnaK PE=3 SV=2 114 554 1.0E-21
sp|Q5WV15|DNAK_LEGPL Chaperone protein DnaK OS=Legionella pneumophila (strain Lens) GN=dnaK PE=3 SV=1 114 554 1.0E-21
sp|Q5X3M7|DNAK_LEGPA Chaperone protein DnaK OS=Legionella pneumophila (strain Paris) GN=dnaK PE=3 SV=1 114 554 1.0E-21
sp|A7I2D4|DNAK_CAMHC Chaperone protein DnaK OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=dnaK PE=3 SV=1 114 531 1.0E-21
sp|A1WX31|DNAK_HALHL Chaperone protein DnaK OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=dnaK PE=3 SV=1 112 615 1.0E-21
sp|Q1IWL4|DNAK_DEIGD Chaperone protein DnaK OS=Deinococcus geothermalis (strain DSM 11300) GN=dnaK PE=3 SV=1 115 530 1.0E-21
sp|B3PF33|DNAK_CELJU Chaperone protein DnaK OS=Cellvibrio japonicus (strain Ueda107) GN=dnaK PE=3 SV=1 112 554 1.0E-21
sp|P48741|HSP77_HUMAN Putative heat shock 70 kDa protein 7 OS=Homo sapiens GN=HSPA7 PE=5 SV=2 115 496 1.0E-21
sp|B8H6Q1|DNAK_ARTCA Chaperone protein DnaK OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=dnaK PE=3 SV=1 237 533 1.0E-21
sp|Q2LUH6|DNAK_SYNAS Chaperone protein DnaK OS=Syntrophus aciditrophicus (strain SB) GN=dnaK PE=3 SV=1 112 533 1.0E-21
sp|Q7VIE3|DNAK_HELHP Chaperone protein DnaK OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=dnaK PE=3 SV=1 114 533 2.0E-21
sp|Q5R511|GRP75_PONAB Stress-70 protein, mitochondrial OS=Pongo abelii GN=HSPA9 PE=2 SV=1 100 534 2.0E-21
sp|B7J282|DNAK_BORBZ Chaperone protein DnaK OS=Borrelia burgdorferi (strain ZS7) GN=dnaK PE=2 SV=1 112 534 2.0E-21
sp|P0C922|DNAK_BORBU Chaperone protein DnaK OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=dnaK PE=2 SV=1 112 534 2.0E-21
sp|Q89YW6|DNAK_BACTN Chaperone protein DnaK OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=dnaK PE=3 SV=1 112 538 2.0E-21
sp|A6T226|DNAK_JANMA Chaperone protein DnaK OS=Janthinobacterium sp. (strain Marseille) GN=dnaK PE=3 SV=1 112 534 2.0E-21
sp|A6GXZ1|DNAK_FLAPJ Chaperone protein DnaK OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=dnaK PE=3 SV=1 237 534 2.0E-21
sp|Q5NFG7|DNAK_FRATT Chaperone protein DnaK OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=dnaK PE=3 SV=1 112 570 2.0E-21
sp|Q14GW9|DNAK_FRAT1 Chaperone protein DnaK OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=dnaK PE=3 SV=1 112 570 2.0E-21
sp|Q0SMZ0|DNAK_BORAP Chaperone protein DnaK OS=Borrelia afzelii (strain PKo) GN=dnaK PE=3 SV=1 112 534 2.0E-21
sp|A4VPQ5|DNAK_PSEU5 Chaperone protein DnaK OS=Pseudomonas stutzeri (strain A1501) GN=dnaK PE=3 SV=1 112 534 2.0E-21
sp|Q661A3|DNAK_BORBP Chaperone protein DnaK OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=dnaK PE=3 SV=1 112 534 2.0E-21
sp|Q0HLN0|DNAK_SHESM Chaperone protein DnaK OS=Shewanella sp. (strain MR-4) GN=dnaK PE=3 SV=1 112 570 2.0E-21
sp|O87712|DNAK_COXBU Chaperone protein DnaK OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=dnaK PE=1 SV=1 114 554 2.0E-21
sp|A9N8H2|DNAK_COXBR Chaperone protein DnaK OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=dnaK PE=3 SV=1 114 554 2.0E-21
sp|A9KG88|DNAK_COXBN Chaperone protein DnaK OS=Coxiella burnetii (strain Dugway 5J108-111) GN=dnaK PE=3 SV=1 114 554 2.0E-21
sp|B6J7U7|DNAK_COXB1 Chaperone protein DnaK OS=Coxiella burnetii (strain CbuK_Q154) GN=dnaK PE=3 SV=1 114 554 2.0E-21
sp|Q0HY11|DNAK_SHESR Chaperone protein DnaK OS=Shewanella sp. (strain MR-7) GN=dnaK PE=3 SV=1 112 570 2.0E-21
sp|B2S0M0|DNAK_BORHD Chaperone protein DnaK OS=Borrelia hermsii (strain HS1 / DAH) GN=dnaK PE=3 SV=1 112 534 2.0E-21
sp|Q64X01|DNAK_BACFR Chaperone protein DnaK OS=Bacteroides fragilis (strain YCH46) GN=dnaK PE=3 SV=1 112 538 2.0E-21
sp|Q5LG30|DNAK_BACFN Chaperone protein DnaK OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=dnaK PE=3 SV=1 112 538 2.0E-21
sp|A6L2X7|DNAK_BACV8 Chaperone protein DnaK OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=dnaK PE=3 SV=1 112 538 2.0E-21
sp|B2GGP0|DNAK_KOCRD Chaperone protein DnaK OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=dnaK PE=3 SV=1 237 614 2.0E-21
sp|B6IZJ0|DNAK_COXB2 Chaperone protein DnaK OS=Coxiella burnetii (strain CbuG_Q212) GN=dnaK PE=3 SV=1 114 554 3.0E-21
sp|P64408|DNAK_STAAW Chaperone protein DnaK OS=Staphylococcus aureus (strain MW2) GN=dnaK PE=3 SV=1 236 534 3.0E-21
sp|A8Z4B9|DNAK_STAAT Chaperone protein DnaK OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=dnaK PE=3 SV=1 236 534 3.0E-21
sp|Q6G8Y7|DNAK_STAAS Chaperone protein DnaK OS=Staphylococcus aureus (strain MSSA476) GN=dnaK PE=3 SV=1 236 534 3.0E-21
sp|Q6GGC0|DNAK_STAAR Chaperone protein DnaK OS=Staphylococcus aureus (strain MRSA252) GN=dnaK PE=3 SV=1 236 534 3.0E-21
sp|P99110|DNAK_STAAN Chaperone protein DnaK OS=Staphylococcus aureus (strain N315) GN=dnaK PE=1 SV=1 236 534 3.0E-21
sp|P64407|DNAK_STAAM Chaperone protein DnaK OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dnaK PE=3 SV=1 236 534 3.0E-21
sp|A6QHC3|DNAK_STAAE Chaperone protein DnaK OS=Staphylococcus aureus (strain Newman) GN=dnaK PE=3 SV=1 236 534 3.0E-21
sp|Q5HFI0|DNAK_STAAC Chaperone protein DnaK OS=Staphylococcus aureus (strain COL) GN=dnaK PE=3 SV=1 236 534 3.0E-21
sp|A5ITA8|DNAK_STAA9 Chaperone protein DnaK OS=Staphylococcus aureus (strain JH9) GN=dnaK PE=3 SV=1 236 534 3.0E-21
sp|Q2FXZ2|DNAK_STAA8 Chaperone protein DnaK OS=Staphylococcus aureus (strain NCTC 8325) GN=dnaK PE=3 SV=1 236 534 3.0E-21
sp|Q2FGE3|DNAK_STAA3 Chaperone protein DnaK OS=Staphylococcus aureus (strain USA300) GN=dnaK PE=3 SV=1 236 534 3.0E-21
sp|A6U252|DNAK_STAA2 Chaperone protein DnaK OS=Staphylococcus aureus (strain JH1) GN=dnaK PE=3 SV=1 236 534 3.0E-21
sp|A7X2Y1|DNAK_STAA1 Chaperone protein DnaK OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=dnaK PE=3 SV=1 236 534 3.0E-21
sp|B1MIX5|DNAK_MYCA9 Chaperone protein DnaK OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=dnaK PE=3 SV=1 237 533 3.0E-21
sp|P45554|DNAK_STAAU Chaperone protein DnaK OS=Staphylococcus aureus GN=dnaK PE=3 SV=1 236 534 3.0E-21
sp|Q7NXI3|DNAK_CHRVO Chaperone protein DnaK OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=dnaK PE=3 SV=1 112 534 3.0E-21
sp|Q93GF1|DNAK_PRELO Chaperone protein DnaK OS=Prevotella loescheii GN=dnaK PE=3 SV=1 112 554 3.0E-21
sp|C0ZB48|DNAK_BREBN Chaperone protein DnaK OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=dnaK PE=3 SV=1 114 615 3.0E-21
sp|Q0BLK4|DNAK_FRATO Chaperone protein DnaK OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=dnaK PE=3 SV=1 112 570 3.0E-21
sp|Q2A328|DNAK_FRATH Chaperone protein DnaK OS=Francisella tularensis subsp. holarctica (strain LVS) GN=dnaK PE=3 SV=1 112 570 3.0E-21
sp|A7NCM9|DNAK_FRATF Chaperone protein DnaK OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=dnaK PE=3 SV=1 112 570 3.0E-21
sp|Q5ZM98|GRP75_CHICK Stress-70 protein, mitochondrial OS=Gallus gallus GN=HSPA9 PE=1 SV=1 105 534 3.0E-21
sp|Q49Y22|DNAK_STAS1 Chaperone protein DnaK OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=dnaK PE=3 SV=1 236 554 4.0E-21
sp|B2G6W3|DNAK_LACRJ Chaperone protein DnaK OS=Lactobacillus reuteri (strain JCM 1112) GN=dnaK PE=3 SV=1 237 534 4.0E-21
sp|A5VJE7|DNAK_LACRD Chaperone protein DnaK OS=Lactobacillus reuteri (strain DSM 20016) GN=dnaK PE=3 SV=1 237 534 4.0E-21
sp|A0KTS5|DNAK_SHESA Chaperone protein DnaK OS=Shewanella sp. (strain ANA-3) GN=dnaK PE=3 SV=1 112 570 4.0E-21
sp|A0Q7F0|DNAK_FRATN Chaperone protein DnaK OS=Francisella tularensis subsp. novicida (strain U112) GN=dnaK PE=3 SV=1 112 570 4.0E-21
sp|A1RGN1|DNAK_SHESW Chaperone protein DnaK OS=Shewanella sp. (strain W3-18-1) GN=dnaK PE=3 SV=1 112 570 4.0E-21
sp|A4Y9Q3|DNAK_SHEPC Chaperone protein DnaK OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=dnaK PE=3 SV=1 112 570 4.0E-21
sp|Q9HHB9|DNAK_HALMT Chaperone protein DnaK OS=Haloferax mediterranei (strain ATCC 33500 / DSM 1411 / JCM 8866 / NBRC 14739 / NCIMB 2177 / R-4) GN=dnaK PE=3 SV=1 114 533 5.0E-21
sp|P48205|DNAK_FRATU Chaperone protein DnaK OS=Francisella tularensis GN=dnaK PE=3 SV=1 112 570 5.0E-21
sp|Q8EHT7|DNAK_SHEON Chaperone protein DnaK OS=Shewanella oneidensis (strain MR-1) GN=dnaK PE=3 SV=1 112 570 5.0E-21
sp|C1F2D2|DNAK_ACIC5 Chaperone protein DnaK OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=dnaK PE=3 SV=1 114 534 5.0E-21
sp|Q1BEV1|DNAK_MYCSS Chaperone protein DnaK OS=Mycobacterium sp. (strain MCS) GN=dnaK PE=3 SV=1 237 533 5.0E-21
sp|A1UA31|DNAK_MYCSK Chaperone protein DnaK OS=Mycobacterium sp. (strain KMS) GN=dnaK PE=3 SV=1 237 533 5.0E-21
sp|A3PTN4|DNAK_MYCSJ Chaperone protein DnaK OS=Mycobacterium sp. (strain JLS) GN=dnaK PE=3 SV=1 237 533 5.0E-21
sp|B2RJ90|DNAK_PORG3 Chaperone protein DnaK OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=dnaK PE=3 SV=1 112 627 5.0E-21
sp|B0KA81|DNAK_THEP3 Chaperone protein DnaK OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=dnaK PE=3 SV=1 112 554 5.0E-21
sp|P0CS91|HSP77_YEASX Heat shock protein SSC1, mitochondrial OS=Saccharomyces cerevisiae GN=SSC1 PE=1 SV=1 110 534 6.0E-21
sp|P0CW12|DNAK_METMZ Chaperone protein DnaK OS=Methanosarcina mazei GN=dnaK PE=3 SV=1 237 570 6.0E-21
sp|P0CW13|DNAK_METMA Chaperone protein DnaK OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=dnaK PE=3 SV=1 237 570 6.0E-21
sp|Q37106|DNAK_CYAPA Chaperone protein dnaK OS=Cyanophora paradoxa GN=dnaK-A PE=3 SV=2 112 520 6.0E-21
sp|Q2YT47|DNAK_STAAB Chaperone protein DnaK OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=dnaK PE=3 SV=1 236 534 6.0E-21
sp|Q8KML6|DNAK_LACSN Chaperone protein DnaK OS=Lactobacillus sanfranciscensis GN=dnaK PE=3 SV=1 114 554 6.0E-21
sp|Q97BG8|DNAK_THEVO Chaperone protein DnaK OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=dnaK PE=3 SV=1 114 533 6.0E-21
sp|Q5HNW6|DNAK_STAEQ Chaperone protein DnaK OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=dnaK PE=3 SV=1 236 534 7.0E-21
sp|Q8TQR2|DNAK_METAC Chaperone protein DnaK OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=dnaK PE=3 SV=1 237 570 7.0E-21
sp|Q00488|DNAK_MYCPA Chaperone protein DnaK OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=dnaK PE=3 SV=4 237 533 7.0E-21
sp|P0CS90|HSP77_YEAST Heat shock protein SSC1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSC1 PE=1 SV=1 110 534 7.0E-21
sp|P0C937|DNAK_PORGI Chaperone protein DnaK OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=dnaK PE=3 SV=1 112 627 7.0E-21
sp|B2TLZ7|DNAK_CLOBB Chaperone protein DnaK OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=dnaK PE=3 SV=1 112 570 7.0E-21
sp|Q8CP17|DNAK_STAES Chaperone protein DnaK OS=Staphylococcus epidermidis (strain ATCC 12228) GN=dnaK PE=3 SV=1 236 534 8.0E-21
sp|B7ID00|DNAK_THEAB Chaperone protein DnaK OS=Thermosipho africanus (strain TCF52B) GN=dnaK PE=3 SV=1 237 534 8.0E-21
sp|Q9XCB1|DNAK_RHOMR Chaperone protein DnaK OS=Rhodothermus marinus GN=dnaK PE=3 SV=1 112 534 8.0E-21
sp|A0QLZ6|DNAK_MYCA1 Chaperone protein DnaK OS=Mycobacterium avium (strain 104) GN=dnaK PE=3 SV=1 237 533 8.0E-21
sp|B2SGV8|DNAK_FRATM Chaperone protein DnaK OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=dnaK PE=3 SV=1 112 570 8.0E-21
sp|B2V2I5|DNAK_CLOBA Chaperone protein DnaK OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=dnaK PE=3 SV=1 112 570 8.0E-21
sp|Q74IT6|DNAK_LACJO Chaperone protein DnaK OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=dnaK PE=3 SV=1 237 554 9.0E-21
sp|Q4L6T0|DNAK_STAHJ Chaperone protein DnaK OS=Staphylococcus haemolyticus (strain JCSC1435) GN=dnaK PE=3 SV=1 236 534 9.0E-21
sp|A6WRU9|DNAK_SHEB8 Chaperone protein DnaK OS=Shewanella baltica (strain OS185) GN=dnaK PE=3 SV=1 112 570 9.0E-21
sp|A3D7T4|DNAK_SHEB5 Chaperone protein DnaK OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=dnaK PE=3 SV=1 112 570 9.0E-21
sp|Q1Q7X0|DNAK_PSYCK Chaperone protein DnaK OS=Psychrobacter cryohalolentis (strain K5) GN=dnaK PE=3 SV=1 112 534 9.0E-21
sp|B1KZN7|DNAK_CLOBM Chaperone protein DnaK OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=dnaK PE=3 SV=1 114 554 9.0E-21
sp|B1ILM3|DNAK_CLOBK Chaperone protein DnaK OS=Clostridium botulinum (strain Okra / Type B1) GN=dnaK PE=3 SV=1 114 554 9.0E-21
sp|A9L0R8|DNAK_SHEB9 Chaperone protein DnaK OS=Shewanella baltica (strain OS195) GN=dnaK PE=3 SV=1 112 570 1.0E-20
sp|C3L3G7|DNAK_CLOB6 Chaperone protein DnaK OS=Clostridium botulinum (strain 657 / Type Ba4) GN=dnaK PE=3 SV=1 114 554 1.0E-20
sp|Q4FPS9|DNAK_PSYA2 Chaperone protein DnaK OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=dnaK PE=3 SV=1 112 534 1.0E-20
sp|A7GHH6|DNAK_CLOBL Chaperone protein DnaK OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=dnaK PE=3 SV=1 114 554 1.0E-20
sp|C1FVU0|DNAK_CLOBJ Chaperone protein DnaK OS=Clostridium botulinum (strain Kyoto / Type A2) GN=dnaK PE=3 SV=1 114 554 1.0E-20
sp|A5I640|DNAK_CLOBH Chaperone protein DnaK OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=dnaK PE=3 SV=1 114 554 1.0E-20
sp|A7FXL5|DNAK_CLOB1 Chaperone protein DnaK OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=dnaK PE=3 SV=1 114 554 1.0E-20
sp|Q2Y6U0|DNAK_NITMU Chaperone protein DnaK OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=dnaK PE=3 SV=1 112 570 1.0E-20
sp|B8E4S1|DNAK_SHEB2 Chaperone protein DnaK OS=Shewanella baltica (strain OS223) GN=dnaK PE=3 SV=1 112 570 1.0E-20
sp|Q2RNE6|DNAK_RHORT Chaperone protein DnaK OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=dnaK PE=3 SV=1 114 533 1.0E-20
sp|B3QMB2|DNAK_CHLP8 Chaperone protein DnaK OS=Chlorobaculum parvum (strain NCIB 8327) GN=dnaK PE=3 SV=1 112 533 1.0E-20
sp|Q8DH10|DNAK3_THEEB Chaperone protein dnaK3 OS=Thermosynechococcus elongatus (strain BP-1) GN=dnaK3 PE=3 SV=1 112 534 1.0E-20
sp|Q044A9|DNAK_LACGA Chaperone protein DnaK OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=dnaK PE=3 SV=1 237 554 1.0E-20
sp|B9DNK0|DNAK_STACT Chaperone protein DnaK OS=Staphylococcus carnosus (strain TM300) GN=dnaK PE=3 SV=1 237 534 1.0E-20
sp|Q6LS31|DNAK2_PHOPR Chaperone protein DnaK 2 OS=Photobacterium profundum GN=dnaK2 PE=3 SV=1 114 554 1.0E-20
sp|Q3BVB8|DNAK_XANC5 Chaperone protein DnaK OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=dnaK PE=3 SV=1 112 554 1.0E-20
sp|Q8RB68|DNAK_CALS4 Chaperone protein DnaK OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=dnaK PE=3 SV=1 112 538 2.0E-20
sp|B0TYF2|DNAK_FRAP2 Chaperone protein DnaK OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=dnaK PE=3 SV=1 112 570 2.0E-20
sp|A6LM32|DNAK_THEM4 Chaperone protein DnaK OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=dnaK PE=3 SV=1 237 534 2.0E-20
sp|B5RM75|DNAK_BORDL Chaperone protein DnaK OS=Borrelia duttonii (strain Ly) GN=dnaK PE=3 SV=1 112 534 2.0E-20
sp|B1J254|DNAK_PSEPW Chaperone protein DnaK OS=Pseudomonas putida (strain W619) GN=dnaK PE=3 SV=1 112 554 2.0E-20
sp|B5RPM1|DNAK_BORRA Chaperone protein DnaK OS=Borrelia recurrentis (strain A1) GN=dnaK PE=3 SV=1 112 534 2.0E-20
sp|Q1LST3|DNAK_BAUCH Chaperone protein DnaK OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=dnaK PE=3 SV=1 112 554 2.0E-20
sp|P22358|DNAK2_SYNY3 Chaperone protein dnaK2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=dnaK2 PE=2 SV=1 112 534 2.0E-20
sp|A5FGL1|DNAK_FLAJ1 Chaperone protein DnaK OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=dnaK PE=3 SV=1 112 554 2.0E-20
sp|P30721|DNAK_CLOAB Chaperone protein DnaK OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=dnaK PE=2 SV=3 114 570 2.0E-20
sp|Q049W6|DNAK_LACDB Chaperone protein DnaK OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=dnaK PE=3 SV=1 236 554 2.0E-20
sp|Q1G9R2|DNAK_LACDA Chaperone protein DnaK OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=dnaK PE=3 SV=1 236 554 2.0E-20
sp|Q8PAK9|DNAK_XANCP Chaperone protein DnaK OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=dnaK PE=3 SV=1 112 554 2.0E-20
sp|B0RVU2|DNAK_XANCB Chaperone protein DnaK OS=Xanthomonas campestris pv. campestris (strain B100) GN=dnaK PE=3 SV=1 112 554 2.0E-20
sp|Q4UT11|DNAK_XANC8 Chaperone protein DnaK OS=Xanthomonas campestris pv. campestris (strain 8004) GN=dnaK PE=3 SV=1 112 554 2.0E-20
sp|A3DF25|DNAK_CLOTH Chaperone protein DnaK OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=dnaK PE=3 SV=1 112 534 2.0E-20
sp|Q74ZJ0|HSP7F_ASHGO Heat shock protein homolog SSE1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SSE1 PE=3 SV=1 264 552 2.0E-20
sp|P59565|DNAK_BUCBP Chaperone protein DnaK OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=dnaK PE=3 SV=1 247 534 2.0E-20
sp|Q5N0G0|DNAK3_SYNP6 Chaperone protein DnaK 3 OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=dnaK3 PE=3 SV=1 112 533 2.0E-20
sp|B4SSQ6|DNAK_STRM5 Chaperone protein DnaK OS=Stenotrophomonas maltophilia (strain R551-3) GN=dnaK PE=3 SV=1 112 554 2.0E-20
sp|Q12Q08|DNAK_SHEDO Chaperone protein DnaK OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=dnaK PE=3 SV=1 112 559 2.0E-20
sp|P11141|HSP7F_CAEEL Heat shock 70 kDa protein F, mitochondrial OS=Caenorhabditis elegans GN=hsp-6 PE=1 SV=2 112 534 2.0E-20
sp|A0Q1R4|DNAK_CLONN Chaperone protein DnaK OS=Clostridium novyi (strain NT) GN=dnaK PE=3 SV=1 112 570 3.0E-20
sp|B8CXL1|DNAK_HALOH Chaperone protein DnaK OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=dnaK PE=3 SV=1 112 534 3.0E-20
sp|Q07US6|DNAK_RHOP5 Chaperone protein DnaK OS=Rhodopseudomonas palustris (strain BisA53) GN=dnaK PE=3 SV=1 112 554 3.0E-20
sp|Q8K9Y8|DNAK_BUCAP Chaperone protein DnaK OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=dnaK PE=3 SV=1 112 534 3.0E-20
sp|C3LTA5|DNAK_VIBCM Chaperone protein DnaK OS=Vibrio cholerae serotype O1 (strain M66-2) GN=dnaK PE=3 SV=1 112 534 3.0E-20
sp|O34241|DNAK_VIBCH Chaperone protein DnaK OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=dnaK PE=3 SV=2 112 534 3.0E-20
sp|A5F361|DNAK_VIBC3 Chaperone protein DnaK OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=dnaK PE=3 SV=1 112 534 3.0E-20
sp|Q87WP0|DNAK_PSESM Chaperone protein DnaK OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=dnaK PE=3 SV=1 112 534 3.0E-20
sp|Q21H36|DNAK_SACD2 Chaperone protein DnaK OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=dnaK PE=3 SV=1 112 554 3.0E-20
sp|A0QQC8|DNAK_MYCS2 Chaperone protein DnaK OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=dnaK PE=1 SV=1 237 533 3.0E-20
sp|B2SQU4|DNAK_XANOP Chaperone protein DnaK OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=dnaK PE=3 SV=1 112 554 3.0E-20
sp|Q2P459|DNAK_XANOM Chaperone protein DnaK OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=dnaK PE=3 SV=1 112 554 3.0E-20
sp|A0T0H7|DNAK_PHATC Chaperone protein dnaK OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=dnaK PE=3 SV=1 112 538 3.0E-20
sp|Q8PMB0|DNAK_XANAC Chaperone protein DnaK OS=Xanthomonas axonopodis pv. citri (strain 306) GN=dnaK PE=3 SV=1 112 554 3.0E-20
sp|Q7N8Y4|DNAK_PHOLL Chaperone protein DnaK OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=dnaK PE=3 SV=1 112 554 4.0E-20
sp|Q98QY7|DNAK_MYCPU Chaperone protein DnaK OS=Mycoplasma pulmonis (strain UAB CTIP) GN=dnaK PE=3 SV=1 114 534 4.0E-20
sp|Q6YPM1|DNAK_ONYPE Chaperone protein DnaK OS=Onion yellows phytoplasma (strain OY-M) GN=dnaK PE=3 SV=2 171 534 4.0E-20
sp|A0LWS7|DNAK_ACIC1 Chaperone protein DnaK OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=dnaK PE=3 SV=1 237 533 4.0E-20
sp|Q5H186|DNAK_XANOR Chaperone protein DnaK OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=dnaK PE=3 SV=1 112 554 4.0E-20
sp|Q12WE6|DNAK_METBU Chaperone protein DnaK OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=dnaK PE=3 SV=1 112 534 4.0E-20
sp|A5V5P9|DNAK_SPHWW Chaperone protein DnaK OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=dnaK PE=3 SV=1 114 533 4.0E-20
sp|C5C3P2|DNAK_BEUC1 Chaperone protein DnaK OS=Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / NBRC 16432) GN=dnaK PE=3 SV=1 236 530 4.0E-20
sp|Q0AKB1|DNAK_MARMM Chaperone protein DnaK OS=Maricaulis maris (strain MCS10) GN=dnaK PE=3 SV=1 114 554 5.0E-20
sp|Q6L0S7|DNAK_PICTO Chaperone protein DnaK OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=dnaK PE=3 SV=1 237 554 5.0E-20
sp|O87777|DNAK_LACSK Chaperone protein DnaK OS=Lactobacillus sakei GN=dnaK PE=2 SV=1 114 554 5.0E-20
sp|A6LDG8|DNAK_PARD8 Chaperone protein DnaK OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=dnaK PE=3 SV=1 112 534 5.0E-20
sp|P50023|DNAK_THEAC Chaperone protein DnaK OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=dnaK PE=3 SV=2 237 533 5.0E-20
sp|Q2YDD0|HSP7E_BOVIN Heat shock 70 kDa protein 14 OS=Bos taurus GN=HSPA14 PE=2 SV=1 113 533 5.0E-20
sp|Q8SSB1|HSP7B_ENCCU Heat shock protein homolog ECU03_0520 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU03_0520 PE=1 SV=1 115 619 5.0E-20
sp|Q38W93|DNAK_LACSS Chaperone protein DnaK OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=dnaK PE=3 SV=1 114 554 5.0E-20
sp|C6DF10|DNAK_PECCP Chaperone protein DnaK OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=dnaK PE=3 SV=1 112 554 5.0E-20
sp|Q84BU4|DNAK_LACAC Chaperone protein DnaK OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=dnaK PE=3 SV=1 114 554 6.0E-20
sp|A1STE4|DNAK_PSYIN Chaperone protein DnaK OS=Psychromonas ingrahamii (strain 37) GN=dnaK PE=3 SV=1 112 534 6.0E-20
sp|Q18GZ4|DNAK_HALWD Chaperone protein DnaK OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=dnaK PE=3 SV=1 237 534 6.0E-20
sp|Q88DU2|DNAK_PSEPK Chaperone protein DnaK OS=Pseudomonas putida (strain KT2440) GN=dnaK PE=3 SV=1 112 554 6.0E-20
sp|Q5YNI0|DNAK_NOCFA Chaperone protein DnaK OS=Nocardia farcinica (strain IFM 10152) GN=dnaK PE=3 SV=1 237 533 7.0E-20
sp|A5FPU4|DNAK_DEHMB Chaperone protein DnaK OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=dnaK PE=3 SV=1 112 533 7.0E-20
sp|B8IHL3|DNAK_METNO Chaperone protein DnaK OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=dnaK PE=3 SV=1 112 533 7.0E-20
sp|Q7UM31|DNAK_RHOBA Chaperone protein DnaK OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=dnaK PE=3 SV=2 114 534 8.0E-20
sp|Q8KEP3|DNAK_CHLTE Chaperone protein DnaK OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=dnaK PE=3 SV=1 112 533 8.0E-20
sp|P64409|DNAK_TROWT Chaperone protein DnaK OS=Tropheryma whipplei (strain Twist) GN=dnaK PE=3 SV=1 237 533 8.0E-20
sp|P64410|DNAK_TROW8 Chaperone protein DnaK OS=Tropheryma whipplei (strain TW08/27) GN=dnaK PE=3 SV=1 237 533 8.0E-20
sp|A0PLQ1|DNAK_MYCUA Chaperone protein DnaK OS=Mycobacterium ulcerans (strain Agy99) GN=dnaK PE=3 SV=1 237 533 8.0E-20
sp|B2HPS1|DNAK_MYCMM Chaperone protein DnaK OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=dnaK PE=3 SV=1 237 533 8.0E-20
sp|Q3ZYV1|DNAK_DEHMC Chaperone protein DnaK OS=Dehalococcoides mccartyi (strain CBDB1) GN=dnaK PE=3 SV=1 112 533 8.0E-20
sp|Q8DKR6|DNAK1_THEEB Chaperone protein dnaK1 OS=Thermosynechococcus elongatus (strain BP-1) GN=dnaK1 PE=3 SV=1 112 542 9.0E-20
sp|Q11QH3|DNAK_CYTH3 Chaperone protein DnaK OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=dnaK PE=3 SV=1 112 534 1.0E-19
sp|B2FMY5|DNAK_STRMK Chaperone protein DnaK OS=Stenotrophomonas maltophilia (strain K279a) GN=dnaK PE=3 SV=1 112 554 1.0E-19
sp|Q7NDH1|DNAK_GLOVI Chaperone protein DnaK OS=Gloeobacter violaceus (strain PCC 7421) GN=dnaK PE=3 SV=1 112 538 1.0E-19
sp|Q21CI2|DNAK_RHOPB Chaperone protein DnaK OS=Rhodopseudomonas palustris (strain BisB18) GN=dnaK PE=3 SV=1 112 554 1.0E-19
sp|A3QGW2|DNAK_SHELP Chaperone protein DnaK OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=dnaK PE=3 SV=1 112 570 1.0E-19
sp|P22623|HSP72_PARLI Heat shock 70 kDa protein II (Fragment) OS=Paracentrotus lividus GN=HSP70II PE=3 SV=1 115 522 1.0E-19
sp|A5W9A3|DNAK_PSEP1 Chaperone protein DnaK OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=dnaK PE=3 SV=1 112 554 1.0E-19
sp|Q72IK5|DNAK_THET2 Chaperone protein DnaK OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=dnaK PE=3 SV=1 115 538 1.0E-19
sp|Q5P1H5|DNAK_AROAE Chaperone protein DnaK OS=Aromatoleum aromaticum (strain EbN1) GN=dnaK PE=3 SV=1 112 570 1.0E-19
sp|Q4R6J2|HSP7E_MACFA Heat shock 70 kDa protein 14 OS=Macaca fascicularis GN=HSPA14 PE=2 SV=1 189 533 1.0E-19
sp|P20583|HSP71_TRYCR Heat shock 70 kDa protein, mitochondrial OS=Trypanosoma cruzi GN=MTP70 PE=3 SV=1 105 526 1.0E-19
sp|B0UR84|DNAK_METS4 Chaperone protein DnaK OS=Methylobacterium sp. (strain 4-46) GN=dnaK PE=3 SV=1 112 533 1.0E-19
sp|Q02028|HSP7S_PEA Stromal 70 kDa heat shock-related protein, chloroplastic OS=Pisum sativum GN=HSP70 PE=2 SV=1 110 534 1.0E-19
sp|Q5GSE1|DNAK_WOLTR Chaperone protein DnaK OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=dnaK PE=3 SV=1 112 538 1.0E-19
sp|Q9STW6|HSP7F_ARATH Heat shock 70 kDa protein 6, chloroplastic OS=Arabidopsis thaliana GN=HSP70-6 PE=1 SV=1 30 534 1.0E-19
sp|B3QZ38|DNAK_CHLT3 Chaperone protein DnaK OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=dnaK PE=3 SV=1 112 533 1.0E-19
sp|P38788|SSZ1_YEAST Ribosome-associated complex subunit SSZ1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSZ1 PE=1 SV=2 114 596 1.0E-19
sp|B3CNB5|DNAK_WOLPP Chaperone protein DnaK OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=dnaK PE=3 SV=1 112 538 1.0E-19
sp|C3K275|DNAK_PSEFS Chaperone protein DnaK OS=Pseudomonas fluorescens (strain SBW25) GN=dnaK PE=3 SV=1 112 534 1.0E-19
sp|Q31HA7|DNAK_THICR Chaperone protein DnaK OS=Thiomicrospira crunogena (strain XCL-2) GN=dnaK PE=3 SV=1 112 534 1.0E-19
sp|A8Z5V5|DNAK_SULMW Chaperone protein DnaK OS=Sulcia muelleri (strain GWSS) GN=dnaK PE=3 SV=1 114 534 1.0E-19
sp|B3ERN8|DNAK_AMOA5 Chaperone protein DnaK OS=Amoebophilus asiaticus (strain 5a2) GN=dnaK PE=3 SV=1 112 534 1.0E-19
sp|Q3IC08|DNAK_PSEHT Chaperone protein DnaK OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=dnaK PE=3 SV=1 112 613 1.0E-19
sp|P56836|DNAK_CHLMU Chaperone protein DnaK OS=Chlamydia muridarum (strain MoPn / Nigg) GN=dnaK PE=3 SV=2 114 533 1.0E-19
sp|Q6D0B7|DNAK_PECAS Chaperone protein DnaK OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=dnaK PE=3 SV=1 112 554 1.0E-19
sp|O88600|HSP74_RAT Heat shock 70 kDa protein 4 OS=Rattus norvegicus GN=Hspa4 PE=1 SV=1 691 935 2.0E-13
sp|Q61316|HSP74_MOUSE Heat shock 70 kDa protein 4 OS=Mus musculus GN=Hspa4 PE=1 SV=1 691 935 2.0E-13
sp|P34932|HSP74_HUMAN Heat shock 70 kDa protein 4 OS=Homo sapiens GN=HSPA4 PE=1 SV=4 691 935 2.0E-13
sp|Q5RDM4|HSP74_PONAB Heat shock 70 kDa protein 4 OS=Pongo abelii GN=HSPA4 PE=2 SV=1 691 935 2.0E-13
sp|Q5ZLK7|HYOU1_CHICK Hypoxia up-regulated protein 1 OS=Gallus gallus GN=HYOU1 PE=2 SV=1 727 923 5.0E-13
sp|Q2TFN9|HSP74_CANLF Heat shock 70 kDa protein 4 OS=Canis lupus familiaris GN=HSPA4 PE=1 SV=1 691 935 5.0E-13
sp|Q5R606|HS105_PONAB Heat shock protein 105 kDa OS=Pongo abelii GN=HSPH1 PE=2 SV=1 699 935 1.0E-12
sp|Q92598|HS105_HUMAN Heat shock protein 105 kDa OS=Homo sapiens GN=HSPH1 PE=1 SV=1 699 935 1.0E-12
sp|Q61699|HS105_MOUSE Heat shock protein 105 kDa OS=Mus musculus GN=Hsph1 PE=1 SV=2 711 935 3.0E-12
sp|Q66HA8|HS105_RAT Heat shock protein 105 kDa OS=Rattus norvegicus GN=Hsph1 PE=1 SV=1 711 935 4.0E-12
sp|Q60446|HS105_CRIGR Heat shock protein 105 kDa OS=Cricetulus griseus GN=HSPH1 PE=2 SV=1 711 935 6.0E-12
sp|Q74ZJ0|HSP7F_ASHGO Heat shock protein homolog SSE1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SSE1 PE=3 SV=1 761 944 8.0E-09
sp|O74225|HSP88_NEUCR Heat shock protein hsp88 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=hsp88 PE=1 SV=1 770 894 4.0E-08
sp|P48722|HS74L_MOUSE Heat shock 70 kDa protein 4L OS=Mus musculus GN=Hspa4l PE=1 SV=2 730 931 8.0E-08
sp|Q9SAB1|HSP7Q_ARATH Heat shock 70 kDa protein 16 OS=Arabidopsis thaliana GN=HSP70-16 PE=2 SV=1 778 901 8.0E-08
sp|O95757|HS74L_HUMAN Heat shock 70 kDa protein 4L OS=Homo sapiens GN=HSPA4L PE=1 SV=3 813 931 2.0E-07
sp|Q10061|LHS1_SCHPO Heat shock protein 70 homolog lhs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1F5.06 PE=3 SV=1 779 922 3.0E-07
sp|Q875P5|HSP7F_LACK1 Heat shock protein homolog SSE1 OS=Lachancea kluyveri (strain ATCC 58438 / CBS 3082 / CCRC 21498 / NBRC 1685 / JCM 7257 / NCYC 543 / NRRL Y-12651) GN=SSE1 PE=3 SV=1 774 928 3.0E-07
sp|Q875V0|HSP7F_NAUCC Heat shock protein homolog SSE1 OS=Naumovozyma castellii (strain ATCC 76901 / CBS 4309 / NBRC 1992 / NRRL Y-12630) GN=SSE1 PE=3 SV=1 739 927 6.0E-07
sp|P36016|LHS1_YEAST Heat shock protein 70 homolog LHS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LHS1 PE=1 SV=1 782 934 3.0E-06
sp|Q556U6|BIP1_DICDI Luminal-binding protein 1 OS=Dictyostelium discoideum GN=bip1-1 PE=3 SV=1 775 919 4.0E-06
sp|P11146|HSP7B_DROME Heat shock 70 kDa protein cognate 2 OS=Drosophila melanogaster GN=Hsc70-2 PE=1 SV=2 794 900 6.0E-06
sp|Q96VB9|HSP7F_CANAL Heat shock protein homolog SSE1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MSI3 PE=1 SV=2 766 894 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0140662 ATP-dependent protein folding chaperone Yes
GO:0017076 purine nucleotide binding No
GO:0043168 anion binding No
GO:0140657 ATP-dependent activity No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0032555 purine ribonucleotide binding No
GO:0005488 binding No
GO:0030554 adenyl nucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:1901363 heterocyclic compound binding No
GO:0032553 ribonucleotide binding No
GO:0000166 nucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0097159 organic cyclic compound binding No
GO:0036094 small molecule binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0044183 protein folding chaperone No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 51 0.45

Transmembrane Domains

Domain # Start End Length
1 93 115 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3487
MALYYTEVAVGRNEQPVILGAAEATSTIDSSASEDHVLVGNRHFRRRGRRAPDFTPPSPLSLAYSRNSCSPSIYA
IALSLATMAVSPRRWRPVMILLLGAFLILWSGGGVAGAVLGVDLGTKYIKAALVKPGIPLDIVLTKDSRRKETSA
VAFKPLRSGVKEGVFPERVYGADAMAIAARFPGEVYPNLKALLGLPVDDDMVREYATRHPALQLKAHPSRGTAAF
QSKTVPETEDAWTVEELLAMELQSVQKNAEAAAGDGSSVRSVVLTVPPFYTTEEKRAVQSAAELAGFKVLGLISD
GLAVGLNYATSRQFPNINEGAKPEYHLVFDMGAGSTSATVMRFQSRTVKDLGKFNKTVQEVQVLGGGWDKTLGGE
ALNHLIMDDMVSRFVASPAAKAISVTTDGVRSHGRAMASIAKEAERVRQVLSANQETSASFEGLYEDVDFRYKLT
RAEFENMAETYAQRVGQAINDAMDMSKIDIRDLTSVILHGGATRTPFVQKALEGAFGSADKLRSNVNADEAAVFG
AGFRAAELSPSFRVKEIRISEGPMYPIGITRTASSGKQLRQRLWTATSPLGGPVKEMTLTEHKDVIVGFYQQVGS
ETRDTKSMSTTNLTDTVAAMKERYPSCVEADIAFKLALGLSSENGEVQVLKAAVECEAEVPEKEGFVDGVKNLLG
LGKKDQKDQQPLTEGDESKEPKTTDGSEEEMKKRDGTEPPVGSASTETAESASPPASEHKTGSAGDETKTEETKM
EETKTEETKTEEAKAEAKAEVKKKKETVSIPVAFTLENAGLPSLTKAELTKAKDRLKAFAASDKARVQREETLNR
LEGYTYKVRDLLEGEAFTSMSTEQERTKLADMASETGDWLYDGGSEATKEELKAKLKVLQDLVAPIQTRVDEAEK
RPTVLSSLKATLNQTAQMMSGLRRQLSEYEQWSSSSSSSSSSSASPSSATASPTGDFDGLEDSDDAPVKEASKDD
SSTAKIVPPPPLYKKEEVDEMEALHESTAKWLLDMEARQSALAPTADPVLLAKDVLEKQQKLEMTGMELALKGVK
SFEKQAKKAGKKADKVKAKAKAKAKAKSKTKDNKDGDKDKGAKRDEEKPAQAKKEEKEKHDEL
Coding >Ophio5|3487
ATGGCTCTGTATTACACAGAGGTAGCGGTAGGGCGGAACGAACAACCTGTCATTCTAGGCGCTGCTGAGGCCACA
TCGACCATTGACTCCAGTGCCAGCGAAGATCACGTGCTGGTTGGAAATCGTCATTTTCGTCGTCGTGGCCGTCGC
GCGCCAGACTTTACTCCTCCCTCTCCTCTCTCGCTTGCGTACTCTCGAAACAGCTGTTCTCCTTCTATCTACGCT
ATCGCGCTCAGCCTCGCCACGATGGCTGTCTCGCCGCGGCGGTGGCGCCCGGTGATGATTCTGCTCCTTGGAGCC
TTTCTCATCCTCTGGTCCGGCGGCGGCGTCGCGGGGGCCGTCCTGGGCGTCGACCTGGGAACCAAGTACATCAAG
GCGGCGTTGGTGAAGCCAGGGATTCCACTCGACATTGTACTCACCAAGGACTCGCGGCGCAAGGAGACTTCGGCC
GTGGCCTTTAAGCCGTTGCGCTCGGGCGTCAAGGAGGGCGTCTTCCCGGAGCGGGTGTACGGCGCTGACGCCATG
GCCATCGCCGCCCGATTCCCCGGCGAAGTCTACCCCAATCTGAAGGCTCTGCTCGGTCTCCCGGTCGACGATGAC
ATGGTACGCGAATACGCAACGCGGCACCCGGCCCTACAGCTCAAGGCGCATCCGAGTCGAGGGACGGCCGCGTTC
CAGAGCAAGACGGTGCCTGAGACGGAGGACGCCTGGACGGTCGAGGAGCTACTGGCCATGGAGCTGCAGAGCGTG
CAGAAGAACGCAGAGGCCGCGGCCGGTGACGGCTCTTCCGTCCGCTCCGTCGTCCTGACCGTGCCACCCTTTTAC
ACGACCGAGGAGAAGCGAGCGGTACAGTCGGCGGCCGAGCTGGCCGGCTTCAAGGTTCTCGGCCTCATCAGCGAC
GGTCTTGCCGTCGGCCTCAACTACGCGACCAGCAGGCAGTTCCCCAACATCAATGAAGGCGCGAAGCCGGAATAT
CACCTCGTCTTTGACATGGGTGCGGGCTCGACCAGCGCCACCGTCATGCGGTTCCAAAGCCGCACAGTCAAGGAC
CTCGGCAAGTTCAACAAGACGGTTCAGGAGGTGCAGGTTCTCGGCGGAGGCTGGGACAAGACGCTCGGCGGCGAA
GCCCTGAACCACCTCATCATGGACGACATGGTCTCTCGCTTCGTCGCGTCGCCCGCGGCAAAAGCCATTTCCGTC
ACGACAGACGGCGTCCGGTCTCACGGTCGCGCCATGGCCTCCATCGCCAAGGAAGCGGAGCGTGTGCGACAGGTG
CTGAGCGCCAATCAGGAAACGTCGGCGAGCTTCGAGGGCCTGTACGAGGATGTCGATTTCCGATACAAGCTCACC
CGCGCCGAATTCGAGAACATGGCCGAGACATATGCCCAGCGAGTCGGTCAAGCGATCAATGACGCGATGGACATG
TCGAAAATTGACATTAGGGACTTGACCTCTGTCATCCTTCACGGCGGCGCGACGCGAACTCCTTTCGTCCAGAAG
GCGCTCGAAGGAGCATTCGGCTCGGCGGACAAGCTACGATCCAACGTCAACGCCGACGAGGCTGCCGTGTTCGGA
GCGGGCTTCCGCGCGGCGGAGCTCAGTCCAAGCTTCCGCGTCAAGGAGATACGGATCTCCGAGGGCCCTATGTAC
CCGATCGGCATCACGCGGACGGCCAGCAGCGGAAAGCAGCTGCGCCAGCGACTGTGGACGGCCACGTCTCCTCTG
GGGGGCCCGGTCAAGGAGATGACGTTGACGGAGCATAAGGATGTCATCGTCGGCTTCTACCAGCAGGTCGGATCG
GAGACCAGGGACACGAAGTCGATGAGCACTACGAACCTGACGGACACCGTGGCGGCCATGAAGGAGCGGTATCCA
TCGTGCGTCGAAGCGGACATTGCCTTTAAACTGGCCCTCGGCTTGAGCTCGGAGAACGGAGAGGTCCAAGTGCTC
AAGGCGGCGGTGGAATGCGAAGCAGAGGTGCCCGAGAAAGAAGGGTTCGTCGACGGGGTCAAGAACTTGCTTGGC
CTGGGCAAGAAGGACCAGAAGGACCAGCAGCCACTGACGGAGGGCGACGAGAGTAAGGAGCCCAAGACGACGGAC
GGTTCCGAGGAGGAGATGAAAAAGAGGGATGGGACCGAGCCGCCGGTCGGTTCTGCGTCGACGGAGACGGCCGAG
AGCGCGTCTCCGCCGGCATCGGAGCATAAGACTGGCTCAGCCGGCGATGAGACCAAGACGGAGGAGACCAAGATG
GAGGAGACCAAGACGGAGGAGACCAAGACGGAGGAGGCCAAGGCGGAGGCCAAAGCGGAAGTCAAGAAGAAGAAG
GAGACTGTGTCGATTCCGGTGGCATTCACTCTCGAGAACGCAGGGCTGCCTTCGCTTACCAAGGCCGAACTCACC
AAGGCCAAGGACAGGCTCAAGGCATTTGCGGCTTCGGACAAGGCCCGGGTACAAAGAGAGGAGACGCTCAACCGG
CTGGAGGGCTACACTTACAAGGTGCGAGACCTGCTGGAAGGGGAGGCGTTCACGTCTATGTCTACGGAGCAAGAA
CGGACAAAGCTGGCGGACATGGCCAGCGAGACGGGCGACTGGCTGTACGATGGCGGCAGCGAGGCGACCAAGGAG
GAGCTCAAGGCCAAACTCAAGGTGCTTCAGGACCTGGTGGCGCCCATCCAGACGCGGGTAGACGAGGCAGAGAAG
CGGCCGACTGTGCTATCATCGCTCAAGGCGACGCTGAACCAGACAGCACAGATGATGAGCGGGCTGCGCAGGCAG
CTGTCCGAGTACGAGCAGTGGTCGTCGTCGTCGTCGTCGTCGTCGTCGTCGTCGGCGAGCCCCTCTTCGGCGACG
GCGTCTCCGACGGGCGACTTTGATGGGCTGGAGGACAGCGACGACGCGCCGGTCAAGGAAGCGAGCAAAGACGAC
TCTTCGACGGCCAAGATTGTGCCGCCGCCGCCGCTGTACAAGAAGGAGGAGGTGGATGAGATGGAGGCGCTGCAC
GAGTCGACGGCCAAGTGGCTACTCGATATGGAGGCGCGTCAGTCGGCGCTAGCGCCGACGGCGGATCCGGTGCTA
CTGGCCAAGGACGTGCTGGAGAAGCAGCAGAAGCTGGAGATGACGGGCATGGAGCTGGCGCTGAAAGGGGTGAAG
AGCTTCGAGAAGCAGGCCAAGAAGGCGGGTAAGAAGGCGGACAAGGTCAAGGCGAAGGCGAAGGCGAAGGCGAAG
GCGAAGAGCAAGACAAAGGACAACAAGGATGGGGACAAGGACAAGGGGGCGAAAAGGGATGAGGAGAAGCCTGCA
CAGGCCAAGAAGGAGGAGAAGGAAAAGCACGACGAGCTG
Transcript >Ophio5|3487
ATGGCTCTGTATTACACAGAGGTAGCGGTAGGGCGGAACGAACAACCTGTCATTCTAGGCGCTGCTGAGGCCACA
TCGACCATTGACTCCAGTGCCAGCGAAGATCACGTGCTGGTTGGAAATCGTCATTTTCGTCGTCGTGGCCGTCGC
GCGCCAGACTTTACTCCTCCCTCTCCTCTCTCGCTTGCGTACTCTCGAAACAGCTGTTCTCCTTCTATCTACGCT
ATCGCGCTCAGCCTCGCCACGATGGCTGTCTCGCCGCGGCGGTGGCGCCCGGTGATGATTCTGCTCCTTGGAGCC
TTTCTCATCCTCTGGTCCGGCGGCGGCGTCGCGGGGGCCGTCCTGGGCGTCGACCTGGGAACCAAGTACATCAAG
GCGGCGTTGGTGAAGCCAGGGATTCCACTCGACATTGTACTCACCAAGGACTCGCGGCGCAAGGAGACTTCGGCC
GTGGCCTTTAAGCCGTTGCGCTCGGGCGTCAAGGAGGGCGTCTTCCCGGAGCGGGTGTACGGCGCTGACGCCATG
GCCATCGCCGCCCGATTCCCCGGCGAAGTCTACCCCAATCTGAAGGCTCTGCTCGGTCTCCCGGTCGACGATGAC
ATGGTACGCGAATACGCAACGCGGCACCCGGCCCTACAGCTCAAGGCGCATCCGAGTCGAGGGACGGCCGCGTTC
CAGAGCAAGACGGTGCCTGAGACGGAGGACGCCTGGACGGTCGAGGAGCTACTGGCCATGGAGCTGCAGAGCGTG
CAGAAGAACGCAGAGGCCGCGGCCGGTGACGGCTCTTCCGTCCGCTCCGTCGTCCTGACCGTGCCACCCTTTTAC
ACGACCGAGGAGAAGCGAGCGGTACAGTCGGCGGCCGAGCTGGCCGGCTTCAAGGTTCTCGGCCTCATCAGCGAC
GGTCTTGCCGTCGGCCTCAACTACGCGACCAGCAGGCAGTTCCCCAACATCAATGAAGGCGCGAAGCCGGAATAT
CACCTCGTCTTTGACATGGGTGCGGGCTCGACCAGCGCCACCGTCATGCGGTTCCAAAGCCGCACAGTCAAGGAC
CTCGGCAAGTTCAACAAGACGGTTCAGGAGGTGCAGGTTCTCGGCGGAGGCTGGGACAAGACGCTCGGCGGCGAA
GCCCTGAACCACCTCATCATGGACGACATGGTCTCTCGCTTCGTCGCGTCGCCCGCGGCAAAAGCCATTTCCGTC
ACGACAGACGGCGTCCGGTCTCACGGTCGCGCCATGGCCTCCATCGCCAAGGAAGCGGAGCGTGTGCGACAGGTG
CTGAGCGCCAATCAGGAAACGTCGGCGAGCTTCGAGGGCCTGTACGAGGATGTCGATTTCCGATACAAGCTCACC
CGCGCCGAATTCGAGAACATGGCCGAGACATATGCCCAGCGAGTCGGTCAAGCGATCAATGACGCGATGGACATG
TCGAAAATTGACATTAGGGACTTGACCTCTGTCATCCTTCACGGCGGCGCGACGCGAACTCCTTTCGTCCAGAAG
GCGCTCGAAGGAGCATTCGGCTCGGCGGACAAGCTACGATCCAACGTCAACGCCGACGAGGCTGCCGTGTTCGGA
GCGGGCTTCCGCGCGGCGGAGCTCAGTCCAAGCTTCCGCGTCAAGGAGATACGGATCTCCGAGGGCCCTATGTAC
CCGATCGGCATCACGCGGACGGCCAGCAGCGGAAAGCAGCTGCGCCAGCGACTGTGGACGGCCACGTCTCCTCTG
GGGGGCCCGGTCAAGGAGATGACGTTGACGGAGCATAAGGATGTCATCGTCGGCTTCTACCAGCAGGTCGGATCG
GAGACCAGGGACACGAAGTCGATGAGCACTACGAACCTGACGGACACCGTGGCGGCCATGAAGGAGCGGTATCCA
TCGTGCGTCGAAGCGGACATTGCCTTTAAACTGGCCCTCGGCTTGAGCTCGGAGAACGGAGAGGTCCAAGTGCTC
AAGGCGGCGGTGGAATGCGAAGCAGAGGTGCCCGAGAAAGAAGGGTTCGTCGACGGGGTCAAGAACTTGCTTGGC
CTGGGCAAGAAGGACCAGAAGGACCAGCAGCCACTGACGGAGGGCGACGAGAGTAAGGAGCCCAAGACGACGGAC
GGTTCCGAGGAGGAGATGAAAAAGAGGGATGGGACCGAGCCGCCGGTCGGTTCTGCGTCGACGGAGACGGCCGAG
AGCGCGTCTCCGCCGGCATCGGAGCATAAGACTGGCTCAGCCGGCGATGAGACCAAGACGGAGGAGACCAAGATG
GAGGAGACCAAGACGGAGGAGACCAAGACGGAGGAGGCCAAGGCGGAGGCCAAAGCGGAAGTCAAGAAGAAGAAG
GAGACTGTGTCGATTCCGGTGGCATTCACTCTCGAGAACGCAGGGCTGCCTTCGCTTACCAAGGCCGAACTCACC
AAGGCCAAGGACAGGCTCAAGGCATTTGCGGCTTCGGACAAGGCCCGGGTACAAAGAGAGGAGACGCTCAACCGG
CTGGAGGGCTACACTTACAAGGTGCGAGACCTGCTGGAAGGGGAGGCGTTCACGTCTATGTCTACGGAGCAAGAA
CGGACAAAGCTGGCGGACATGGCCAGCGAGACGGGCGACTGGCTGTACGATGGCGGCAGCGAGGCGACCAAGGAG
GAGCTCAAGGCCAAACTCAAGGTGCTTCAGGACCTGGTGGCGCCCATCCAGACGCGGGTAGACGAGGCAGAGAAG
CGGCCGACTGTGCTATCATCGCTCAAGGCGACGCTGAACCAGACAGCACAGATGATGAGCGGGCTGCGCAGGCAG
CTGTCCGAGTACGAGCAGTGGTCGTCGTCGTCGTCGTCGTCGTCGTCGTCGTCGGCGAGCCCCTCTTCGGCGACG
GCGTCTCCGACGGGCGACTTTGATGGGCTGGAGGACAGCGACGACGCGCCGGTCAAGGAAGCGAGCAAAGACGAC
TCTTCGACGGCCAAGATTGTGCCGCCGCCGCCGCTGTACAAGAAGGAGGAGGTGGATGAGATGGAGGCGCTGCAC
GAGTCGACGGCCAAGTGGCTACTCGATATGGAGGCGCGTCAGTCGGCGCTAGCGCCGACGGCGGATCCGGTGCTA
CTGGCCAAGGACGTGCTGGAGAAGCAGCAGAAGCTGGAGATGACGGGCATGGAGCTGGCGCTGAAAGGGGTGAAG
AGCTTCGAGAAGCAGGCCAAGAAGGCGGGTAAGAAGGCGGACAAGGTCAAGGCGAAGGCGAAGGCGAAGGCGAAG
GCGAAGAGCAAGACAAAGGACAACAAGGATGGGGACAAGGACAAGGGGGCGAAAAGGGATGAGGAGAAGCCTGCA
CAGGCCAAGAAGGAGGAGAAGGAAAAGCACGACGAGCTGTAG
Gene >Ophio5|3487
ATGGCTCTGTATTACACAGAGGTAGCGGTAGGTAGGTACCCGCAGGGCATGTTGGGTGGGGGCCTTTTAGGGGTC
CACCCCTCCGTCCCTGTACTACCTAGGTACCTACCTGTCTACCTAACCTAAAGCCTCTGCAAGGTACGTCAGGGC
GGAACGAACAACCTGTCATTCTAGGCGCTGCTGAGGCCACATCGACCATTGACTCCAGTGCCAGCGAAGATCACG
GTCGACGATCCGCCCACGCTCACCATTCAGTTCTCTTTCTGTGTGAGTGCTGGTTGGAAATCGTCATTTTCGTCG
TCGTGGCCGTCGCGCGCCAGTCAGCCACCTCCGTCCCTCGCCAACGAAACTCGATGCCCTGCTGAGAGGGCCTTA
GGACTTTACTCCTCCCTCTCCTCTCTCGCTTGCGTACTCTCGAAACAGCTGTTCTCCTTCTATCTACGCTATCGC
GCTCAGCCTCGCCACGATGGCTGTCTCGCCGCGGCGGTGGCGCCCGGTGATGATTCTGCTCCTTGGAGCCTTTCT
CATCCTCTGGTCCGGCGGCGGCGTCGCGGGGGCCGTCCTGGGCGTCGACCTGGGAACCAAGTACATCAAGGCGGC
GTTGGTGAAGCCAGGGATTCCACTCGACATTGTACTCACCAAGGACTCGCGGCGCAAGGAGACTTCGGCCGTGGC
CTTTAAGCCGTTGCGCTCGGGCGTCAAGGAGGGCGTCTTCCCGGAGCGGGTGTACGGCGCTGACGCCATGGCCAT
CGCCGCCCGATTCCCCGGCGAAGTCTACCCCAATCTGAAGGCTCTGCTCGGTCTCCCGGTCGACGATGACATGGT
ACGCGAATACGCAACGCGGCACCCGGCCCTACAGCTCAAGGCGCATCCGAGTCGAGGGACGGCCGCGTTCCAGAG
CAAGACGGTGCCTGAGACGGAGGACGCCTGGACGGTCGAGGAGCTACTGGCCATGGAGCTGCAGAGCGTGCAGAA
GAACGCAGAGGCCGCGGCCGGTGACGGCTCTTCCGTCCGCTCCGTCGTCCTGACCGTGCCACCCTTTTACACGAC
CGAGGAGAAGCGAGCGGTACAGTCGGCGGCCGAGCTGGCCGGCTTCAAGGTTCTCGGCCTCATCAGCGACGGTCT
TGCCGTCGGCCTCAACTACGCGACCAGCAGGCAGTTCCCCAACATCAATGAAGGCGCGAAGCCGGAATATCACCT
CGTCTTTGACATGGGTGCGGGCTCGACCAGCGCCACCGTCATGCGGTTCCAAAGCCGCACAGTCAAGGACCTCGG
CAAGTTCAACAAGACGGTTCAGGAGGTGCAGGTTCTCGGCGGAGGCTGGGACAAGACGCTCGGCGGCGAAGCCCT
GAACCACCTCATCATGGACGACATGGTCTCTCGCTTCGTCGCGTCGCCCGCGGCAAAAGCCATTTCCGTCACGAC
AGACGGCGTCCGGTCTCACGGTCGCGCCATGGCCTCCATCGCCAAGGAAGCGGAGCGTGTGCGACAGGTGCTGAG
CGCCAATCAGGAAACGTCGGCGAGCTTCGAGGGCCTGTACGAGGATGTCGATTTCCGATACAAGCTCACCCGCGC
CGAATTCGAGAACATGGCCGAGACATATGCCCAGCGAGTCGGTCAAGCGATCAATGACGCGATGGACATGTCGAA
AATTGACATTAGGGACTTGACCTCTGTCATCCTTCACGGCGGCGCGACGCGAACTCCTTTCGTCCAGAAGGCGCT
CGAAGGAGCATTCGGCTCGGCGGACAAGCTACGATCCAACGTCAACGCCGACGAGGCTGCCGTGTTCGGAGCGGG
CTTCCGCGCGGCGGAGCTCAGTCCAAGCTTCCGCGTCAAGGAGATACGGATCTCCGAGGGCCCTATGTACCCGAT
CGGCATCACGCGGACGGCCAGCAGCGGAAAGCAGCTGCGCCAGCGACTGTGGACGGCCACGTCTCCTCTGGGGGG
CCCGGTCAAGGAGATGACGTTGACGGAGCATAAGGATGTCATCGTCGGCTTCTACCAGCAGGTCGGATCGGAGAC
CAGGGACACGAAGTCGATGAGCACTACGAACCTGACGGACACCGTGGCGGCCATGAAGGAGCGGTATCCATCGTG
CGTCGAAGCGGACATTGCCTTTAAACTGGCCCTCGGCTTGAGCTCGGAGAACGGAGAGGTCCAAGTGCTCAAGGC
GGCGGTGGAATGCGAAGCAGAGGTGCCCGAGAAAGAAGGGTTCGTCGACGGGGTCAAGAACTTGCTTGGCCTGGG
CAAGAAGGACCAGAAGGACCAGCAGCCACTGACGGAGGGCGACGAGAGTAAGGAGCCCAAGACGACGGACGGTTC
CGAGGAGGAGATGAAAAAGAGGGATGGGACCGAGCCGCCGGTCGGTTCTGCGTCGACGGAGACGGCCGAGAGCGC
GTCTCCGCCGGCATCGGAGCATAAGACTGGCTCAGCCGGCGATGAGACCAAGACGGAGGAGACCAAGATGGAGGA
GACCAAGACGGAGGAGACCAAGACGGAGGAGGCCAAGGCGGAGGCCAAAGCGGAAGTCAAGAAGAAGAAGGAGAC
TGTGTCGATTCCGGTGGCATTCACTCTCGAGAACGCAGGGCTGCCTTCGCTTACCAAGGCCGAACTCACCAAGGC
CAAGGACAGGCTCAAGGCATTTGCGGCTTCGGACAAGGCCCGGGTACAAAGAGAGGAGACGCTCAACCGGCTGGA
GGGCTACACTTACAAGGTGCGAGACCTGCTGGAAGGGGAGGCGTTCACGTCTATGTCTACGGAGCAAGAACGGAC
AAAGCTGGCGGACATGGCCAGCGAGACGGGCGACTGGCTGTACGATGGCGGCAGCGAGGCGACCAAGGAGGAGCT
CAAGGCCAAACTCAAGGTGCTTCAGGACCTGGTGGCGCCCATCCAGACGCGGGTAGACGAGGCAGAGAAGCGGCC
GACTGTGCTATCATCGCTCAAGGCGACGCTGAACCAGACAGCACAGATGATGAGCGGGCTGCGCAGGCAGCTGTC
CGAGTACGAGCAGTGGTCGTCGTCGTCGTCGTCGTCGTCGTCGTCGTCGGCGAGCCCCTCTTCGGCGACGGCGTC
TCCGACGGGCGACTTTGATGGGCTGGAGGACAGCGACGACGCGCCGGTCAAGGAAGCGAGCAAAGACGACTCTTC
GACGGCCAAGATTGTGCCGCCGCCGCCGCTGTACAAGAAGGAGGAGGTGGATGAGATGGAGGCGCTGCACGAGTC
GACGGCCAAGTGGCTACTCGATATGGAGGCGCGTCAGTCGGCGCTAGCGCCGACGGCGGATCCGGTGCTACTGGC
CAAGGACGTGCTGGAGAAGCAGCAGAAGCTGGAGATGACGGGCATGGAGCTGGCGCTGAAAGGGGTGAAGAGCTT
CGAGAAGCAGGCCAAGAAGGCGGGTAAGAAGGCGGACAAGGTCAAGGCGAAGGCGAAGGCGAAGGCGAAGGCGAA
GAGCAAGACAAAGGACAACAAGGATGGGGACAAGGACAAGGGGGCGAAAAGGGATGAGGAGAAGCCTGCACAGGC
CAAGAAGGAGGAGAAGGAAAAGCACGACGAGCTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail