Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3483
Gene name
Locationscaffold_276:15761..16163
Strand+
Gene length (bp)402
Transcript length (bp)402
Coding sequence length (bp)399
Protein length (aa) 133

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.5

Transmembrane Domains

Domain # Start End Length
1 49 71 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 535.85 290.53 781.16
CcL In ants, during behavior modification 153.21 73.18 233.23
CcD In ants, recently dead 161.41 80.71 242.11

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.000286 yes
SC16a CcD 0.000286 yes
CcL CcD 0.870003 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3483
MTTIEIVTITNSDGSKVEQTSTARITTTPGLNAGTATPEKSSMSTKTRNTIIGVVVGIGGAIALGALFLLGRRMW
WGKKKSEESDGLMDYDMAVTGGEKPDRGSAAARGPRSPFQSTLENYHQPTQVNASSNF
Coding >Ophio5|3483
ATGACCACAATTGAAATCGTCACCATCACCAACAGTGATGGCTCCAAGGTGGAGCAGACGTCGACAGCAAGAATC
ACCACGACGCCCGGTCTAAATGCCGGCACCGCGACTCCCGAGAAATCTAGTATGAGCACTAAGACGCGCAACACC
ATCATCGGCGTCGTCGTCGGCATTGGCGGCGCAATCGCCCTCGGGGCTTTGTTCCTCTTGGGTCGGCGAATGTGG
TGGGGCAAGAAGAAGTCGGAGGAAAGCGACGGCCTCATGGACTATGACATGGCTGTCACCGGCGGCGAGAAGCCT
GACCGGGGAAGCGCAGCAGCCCGTGGCCCGCGTAGCCCTTTCCAGTCGACGCTGGAAAACTACCACCAACCGACT
CAGGTCAACGCATCGTCGAATTTC
Transcript >Ophio5|3483
ATGACCACAATTGAAATCGTCACCATCACCAACAGTGATGGCTCCAAGGTGGAGCAGACGTCGACAGCAAGAATC
ACCACGACGCCCGGTCTAAATGCCGGCACCGCGACTCCCGAGAAATCTAGTATGAGCACTAAGACGCGCAACACC
ATCATCGGCGTCGTCGTCGGCATTGGCGGCGCAATCGCCCTCGGGGCTTTGTTCCTCTTGGGTCGGCGAATGTGG
TGGGGCAAGAAGAAGTCGGAGGAAAGCGACGGCCTCATGGACTATGACATGGCTGTCACCGGCGGCGAGAAGCCT
GACCGGGGAAGCGCAGCAGCCCGTGGCCCGCGTAGCCCTTTCCAGTCGACGCTGGAAAACTACCACCAACCGACT
CAGGTCAACGCATCGTCGAATTTCTGA
Gene >Ophio5|3483
ATGACCACAATTGAAATCGTCACCATCACCAACAGTGATGGCTCCAAGGTGGAGCAGACGTCGACAGCAAGAATC
ACCACGACGCCCGGTCTAAATGCCGGCACCGCGACTCCCGAGAAATCTAGTATGAGCACTAAGACGCGCAACACC
ATCATCGGCGTCGTCGTCGGCATTGGCGGCGCAATCGCCCTCGGGGCTTTGTTCCTCTTGGGTCGGCGAATGTGG
TGGGGCAAGAAGAAGTCGGAGGAAAGCGACGGCCTCATGGACTATGACATGGCTGTCACCGGCGGCGAGAAGCCT
GACCGGGGAAGCGCAGCAGCCCGTGGCCCGCGTAGCCCTTTCCAGTCGACGCTGGAAAACTACCACCAACCGACT
CAGGTCAACGCATCGTCGAATTTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail