Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3463
Gene name
Locationscaffold_274:17780..19106
Strand-
Gene length (bp)1326
Transcript length (bp)1188
Coding sequence length (bp)1185
Protein length (aa) 395

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9STX2|VEP1_ARATH 3-oxo-Delta(4,5)-steroid 5-beta-reductase OS=Arabidopsis thaliana GN=VEP1 PE=1 SV=1 10 378 6.0E-11
sp|O74913|YJ72_SCHPO Uncharacterized protein C757.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC757.02c PE=4 SV=1 10 394 5.0E-10

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6404 0.3987 0.3553 0.1717 0.0519 0.0052 0.0153 0.0821 0.0966 0.1862

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup6180
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|02219
Ophiocordyceps camponoti-rufipedis Ophun1|6044
Ophiocordyceps kimflemingae Ophio5|3463 (this protein)
Ophiocordyceps subramaniannii Hirsu2|5512

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3463
MADHDDDNHALVFGATGLLGWGVLEQLLAGYPHKGAFSTVTAVVRRTPAGGAAELGLSPAEEFRLAGGVDLLAEE
VDLARRLRERVPGVERTTHVFYYVFTALTDDEVREVEINRNMLQRVVDALNVVSPRLRSFVYAGGTKQYGIYAPG
GTWSAPLEESMTERLQPETMPSCVYPAHRRVLTEASRGRDWVWTELCPDAVVGFSPFGAAFSLALHWAQYLSLYA
AKEGAGAIVSFPGRVAAYEAKFTPVSSRILGRASIYTGLRHLLPDHGGVDGKVINVADSATPVCFRQLWPEVAAW
FGLVGVAPDDEATRPKPGAYLDQHGALFAARGKPRALARGVGAGRDRLDSVGWWLTFDRFMTLGRLRDMGFVEER
GLVDGWYETFERLREADIIL
Coding >Ophio5|3463
ATGGCCGACCACGACGACGACAACCACGCACTAGTCTTTGGCGCAACCGGCCTACTGGGCTGGGGCGTGCTCGAG
CAGCTGCTGGCGGGATATCCACACAAGGGGGCCTTTTCCACCGTCACGGCCGTGGTCCGCCGGACGCCGGCCGGA
GGGGCGGCCGAGCTCGGTCTGTCGCCGGCCGAGGAGTTCCGGTTGGCGGGCGGTGTCGACCTGCTGGCGGAAGAG
GTGGATCTGGCGCGACGACTGAGGGAGAGGGTGCCGGGGGTGGAGAGGACGACGCACGTCTTTTACTATGTCTTT
ACGGCCTTGACGGATGACGAGGTACGAGAGGTGGAGATTAACCGCAATATGCTGCAGCGCGTCGTTGACGCCCTC
AACGTCGTCTCTCCCCGCCTCCGAAGCTTCGTTTACGCCGGCGGTACAAAGCAATACGGCATCTACGCACCCGGC
GGCACGTGGTCGGCACCACTCGAAGAGTCGATGACGGAGCGTCTACAACCGGAGACGATGCCATCGTGTGTTTAC
CCTGCGCACCGAAGAGTACTGACGGAGGCGAGTCGTGGCCGGGACTGGGTCTGGACGGAACTTTGTCCGGACGCG
GTCGTGGGCTTCAGCCCTTTCGGCGCTGCGTTTTCCCTGGCTCTGCACTGGGCGCAGTATCTATCTCTATACGCG
GCCAAGGAGGGAGCTGGAGCTATAGTTTCCTTCCCGGGCCGTGTGGCGGCTTACGAAGCCAAGTTTACGCCTGTC
TCGAGCCGGATCCTGGGGAGGGCTTCCATCTACACGGGGCTACGACATCTCTTACCCGATCATGGCGGCGTGGAC
GGCAAGGTGATAAACGTGGCGGATAGTGCAACGCCTGTCTGCTTTCGCCAGCTGTGGCCCGAGGTGGCGGCTTGG
TTTGGCCTTGTTGGCGTGGCCCCTGACGACGAGGCGACGAGGCCGAAGCCGGGAGCGTATCTTGACCAACACGGA
GCACTCTTCGCCGCTCGTGGAAAGCCGAGGGCGCTGGCTCGCGGTGTGGGCGCGGGTCGTGATAGGCTCGATAGT
GTTGGTTGGTGGTTGACTTTTGACAGGTTCATGACTTTGGGTCGGTTGAGGGATATGGGCTTTGTGGAGGAGAGG
GGCTTGGTTGATGGGTGGTATGAGACGTTTGAGCGGTTGCGGGAGGCGGACATTATTCTC
Transcript >Ophio5|3463
ATGGCCGACCACGACGACGACAACCACGCACTAGTCTTTGGCGCAACCGGCCTACTGGGCTGGGGCGTGCTCGAG
CAGCTGCTGGCGGGATATCCACACAAGGGGGCCTTTTCCACCGTCACGGCCGTGGTCCGCCGGACGCCGGCCGGA
GGGGCGGCCGAGCTCGGTCTGTCGCCGGCCGAGGAGTTCCGGTTGGCGGGCGGTGTCGACCTGCTGGCGGAAGAG
GTGGATCTGGCGCGACGACTGAGGGAGAGGGTGCCGGGGGTGGAGAGGACGACGCACGTCTTTTACTATGTCTTT
ACGGCCTTGACGGATGACGAGGTACGAGAGGTGGAGATTAACCGCAATATGCTGCAGCGCGTCGTTGACGCCCTC
AACGTCGTCTCTCCCCGCCTCCGAAGCTTCGTTTACGCCGGCGGTACAAAGCAATACGGCATCTACGCACCCGGC
GGCACGTGGTCGGCACCACTCGAAGAGTCGATGACGGAGCGTCTACAACCGGAGACGATGCCATCGTGTGTTTAC
CCTGCGCACCGAAGAGTACTGACGGAGGCGAGTCGTGGCCGGGACTGGGTCTGGACGGAACTTTGTCCGGACGCG
GTCGTGGGCTTCAGCCCTTTCGGCGCTGCGTTTTCCCTGGCTCTGCACTGGGCGCAGTATCTATCTCTATACGCG
GCCAAGGAGGGAGCTGGAGCTATAGTTTCCTTCCCGGGCCGTGTGGCGGCTTACGAAGCCAAGTTTACGCCTGTC
TCGAGCCGGATCCTGGGGAGGGCTTCCATCTACACGGGGCTACGACATCTCTTACCCGATCATGGCGGCGTGGAC
GGCAAGGTGATAAACGTGGCGGATAGTGCAACGCCTGTCTGCTTTCGCCAGCTGTGGCCCGAGGTGGCGGCTTGG
TTTGGCCTTGTTGGCGTGGCCCCTGACGACGAGGCGACGAGGCCGAAGCCGGGAGCGTATCTTGACCAACACGGA
GCACTCTTCGCCGCTCGTGGAAAGCCGAGGGCGCTGGCTCGCGGTGTGGGCGCGGGTCGTGATAGGCTCGATAGT
GTTGGTTGGTGGTTGACTTTTGACAGGTTCATGACTTTGGGTCGGTTGAGGGATATGGGCTTTGTGGAGGAGAGG
GGCTTGGTTGATGGGTGGTATGAGACGTTTGAGCGGTTGCGGGAGGCGGACATTATTCTCTGA
Gene >Ophio5|3463
ATGGCCGACCACGACGACGACAACCACGCACTAGTCTTTGGCGCAACCGGCCTACTGGGCTGGGGCGTGCTCGAG
CAGCTGCTGGCGGGATATCCACACAAGGGGGCCTTTTCCACCGTCACGGCCGTGGTCCGCCGGACGCCGGCCGGA
GGGGCGGCCGAGCTCGGTCTGTCGCCGGCCGAGGAGTTCCGGTTGGCGGGCGGTGTCGACCTGCTGGCGGAAGAG
GTGGATCTGGCGCGACGACTGAGGGAGAGGGTGCCGGGGGTGGAGAGGACGACGCACGTCTTTTACTATGGTGAT
TATCATTTCCTTTTTTTTTCTTTTTGCCCTGAGATTGCTTACGCTGCTTCAGTCTTTACGGCCTTGACGGATGAC
GAGGTACGAGAGGTGGAGATTAACCGCAATATGCTGCAGCGCGTCGTTGACGCCCTCAACGTCGTCTCTCCCCGC
CTCCGAAGCTTCGTTTACGCCGGCGGTACAAAGGTTGACCATTAAGTTTCCTTCTATTCACTTGCAAGAAGGGGG
GGGGGGGGAAAAACAGCGGCTGACAAGCAACGACACAAGCAATACGGCATCTACGCACCCGGCGGCACGTGGTCG
GCACCACTCGAAGAGTCGATGACGGAGCGTCTACAACCGGAGACGATGCCATCGTGTGTTTACCCTGCGCACCGA
AGAGTACTGACGGAGGCGAGTCGTGGCCGGGACTGGGTCTGGACGGAACTTTGTCCGGACGCGGTCGTGGGCTTC
AGCCCTTTCGGCGCTGCGTTTTCCCTGGCTCTGCACTGGGCGCAGTATCTATCTCTATACGCGGCCAAGGAGGGA
GCTGGAGCTATAGTTTCCTTCCCGGGCCGTGTGGCGGCTTACGAAGCCAAGTTTACGCCTGTCTCGAGCCGGATC
CTGGGGAGGGCTTCCATCTACACGGGGCTACGACATCTCTTACCCGATCATGGCGGCGTGGACGGCAAGGTGATA
AACGTGGCGGATAGTGCAACGCCTGTCTGCTTTCGCCAGCTGTGGCCCGAGGTGGCGGCTTGGTTTGGCCTTGTT
GGCGTGGCCCCTGACGACGAGGCGACGAGGCCGAAGCCGGGAGCGTATCTTGACCAACACGGAGCACTCTTCGCC
GCTCGTGGAAAGCCGAGGGCGCTGGCTCGCGGTGTGGGCGCGGGTCGTGATAGGCTCGATAGTGTTGGTTGGTGG
TTGACTTTTGACAGGTTCATGACTTTGGGTCGGTTGAGGGATATGGGCTTTGTGGAGGAGAGGGGCTTGGTTGAT
GGGTGGTATGAGACGTTTGAGCGGTTGCGGGAGGCGGACATTATTCTCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail