Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3447
Gene name
Locationscaffold_273:9933..12539
Strand-
Gene length (bp)2606
Transcript length (bp)2493
Coding sequence length (bp)2490
Protein length (aa) 830

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF19343 DUF5923 Family of unknown function (DUF5923) 2.5E-244 3 609
PF14613 DUF4449 Protein of unknown function (DUF4449) 5.2E-65 621 783

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q10327|YD72_SCHPO Uncharacterized protein C32A11.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC32A11.02c PE=4 SV=1 8 773 1.0E-85

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion 0.4292 0.1469 0.197 0.2756 0.6824 0.0041 0.4565 0.4356 0.2514 0.2855

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2326
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3392
Ophiocordyceps australis map64 (Brazil) OphauB2|5783
Ophiocordyceps camponoti-floridani Ophcf2|05974
Ophiocordyceps camponoti-rufipedis Ophun1|7373
Ophiocordyceps kimflemingae Ophio5|3447 (this protein)
Ophiocordyceps subramaniannii Hirsu2|3159

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3447
MAANVNKPTDSKQKEADINRKLQLYGIFSAFQLGKVPSNDQIDVALNSFLASKALSEPDPKLSDDGKLLVKDTRE
MIQKAQHLLLSKNEGNLVQDFIWQTTQFDTKSIHGPDRPIDKDSFKRDGDETLKGLRTLGTLLITNGQFRKLLKD
ASVLLRDMAGDAASNAATFVRPSEDQLAQMDTAAPDNTWYDAPDLSKDSLKKQAQNIYGGSAKKDAKDVASSAAN
AAGSTDPRAADKTAGQNAVLSAAKSKIDQNLDPETKEKIKKRNEEYRLKAKEYFNKKMPQERKDQIIFRLKKMIL
ECQQHQDYSEAIQTLLRLAETYGRHGRSMGEGSAGSAKKARSGFAAAENDLRTLIERFANGTSTAELWATIRQMY
EAADKDSELKGWFKSMNSYIRRCLLEQGYILEESSTREWDRLYEHGRFLLRDKYRHQTDQVIDEVKFIGDQFDQD
VHNKAFGNSVQKLVNHLGQDSQGKAAFKPHLLKDLGEVILPSLLQNINYIPIPRIEYVDPQFEVAIENLVLESDN
FMPNVFEIASENFFRWGRKNLGSKNHNMIDVKVAGIQMDLRDVSYYVKRKAGFPAISDLGVADILLPGNGLSFRM
KVSTADKTDRQNFFKVNKVDVDFKGLNIKLKQSHHKFLFALVKPLMLTILRPPIQKAVEKAIKDQCNNLDAEMYQ
IKQEADRAAKEGQTDAEKQENFYTRYYQAAQKRFLDGKEKKKEEAKDKVDDKKVNVAMTMEDSILPDVKLPGGVS
IKATEYKELARKGEKWESPVFSIGSAKKSTNVPAAPRIEKKTRPPPSTTNGRSAAAAAVNGKAPVTANANVPGQS
HLSAY
Coding >Ophio5|3447
ATGGCTGCCAACGTGAACAAGCCCACCGACTCCAAGCAGAAGGAGGCCGATATCAACCGGAAGCTCCAGCTGTAC
GGCATCTTCAGTGCCTTTCAGCTCGGCAAGGTGCCTTCGAATGACCAAATCGATGTCGCCCTCAACAGCTTTCTC
GCCTCCAAGGCGCTCAGCGAACCCGACCCGAAGCTGTCCGACGATGGGAAGCTACTTGTCAAGGATACGCGCGAA
ATGATTCAAAAGGCCCAGCACCTTCTCCTGTCCAAGAACGAGGGCAACTTGGTCCAAGACTTTATTTGGCAAACT
ACGCAGTTTGACACCAAGAGCATCCACGGACCTGACCGTCCCATCGATAAGGACAGTTTCAAGCGCGATGGCGAC
GAGACGCTCAAGGGTCTGAGGACGCTCGGCACACTGCTCATTACGAATGGCCAGTTCCGCAAGCTCCTCAAGGAT
GCCTCTGTCCTCCTCCGCGACATGGCCGGTGATGCCGCTAGCAACGCCGCGACTTTCGTCCGCCCCTCTGAGGAT
CAGCTTGCCCAGATGGACACTGCGGCACCTGACAACACGTGGTACGACGCTCCCGATCTCTCCAAGGACAGCTTG
AAGAAGCAGGCCCAGAACATCTACGGCGGAAGCGCCAAGAAGGATGCCAAGGACGTCGCGTCATCGGCTGCCAAC
GCCGCTGGCTCCACGGACCCCAGGGCTGCCGACAAGACGGCCGGGCAGAACGCCGTCCTCTCCGCAGCCAAGAGC
AAGATCGATCAGAACCTTGACCCGGAGACGAAGGAGAAGATCAAGAAGCGCAATGAAGAGTATCGCCTCAAGGCT
AAGGAATACTTCAATAAGAAGATGCCGCAGGAGCGCAAGGACCAGATCATCTTCCGTCTGAAGAAGATGATCCTC
GAGTGCCAGCAACACCAGGACTACTCGGAAGCTATTCAGACTCTACTCAGGCTCGCCGAGACGTATGGCCGCCAC
GGTCGCTCCATGGGCGAGGGATCGGCCGGCTCGGCCAAAAAGGCTCGGTCCGGCTTCGCTGCCGCCGAGAACGAT
TTGCGCACTCTCATCGAGCGCTTCGCTAATGGCACCTCGACGGCTGAACTTTGGGCGACCATCCGCCAGATGTAC
GAGGCCGCTGACAAGGATTCGGAGCTCAAGGGCTGGTTCAAGAGCATGAACAGTTACATCCGCCGCTGCTTGCTC
GAGCAGGGCTACATTCTCGAAGAGTCGTCGACGAGGGAGTGGGACCGTCTCTACGAGCATGGCAGGTTCCTCCTC
CGTGACAAGTATCGTCATCAGACGGATCAGGTCATCGACGAAGTCAAGTTCATCGGCGACCAATTCGATCAGGAT
GTGCACAATAAGGCCTTTGGCAACTCGGTCCAGAAGCTCGTCAACCACCTGGGTCAGGATTCCCAGGGCAAGGCC
GCCTTCAAGCCGCACCTGCTGAAGGATCTCGGCGAGGTGATTTTGCCCAGCCTCCTGCAGAACATCAACTACATC
CCCATTCCGCGCATCGAGTACGTGGATCCTCAGTTCGAGGTCGCCATTGAGAACTTGGTGCTCGAGAGCGACAAC
TTCATGCCCAACGTGTTTGAAATCGCCAGCGAGAACTTCTTCCGTTGGGGCCGCAAGAACCTCGGCAGCAAGAAT
CACAACATGATTGACGTCAAGGTTGCTGGCATCCAGATGGACCTCCGCGATGTCAGTTACTATGTGAAGCGCAAG
GCTGGCTTCCCCGCCATCAGCGACTTGGGCGTGGCCGACATCCTCCTCCCCGGCAACGGCTTGTCGTTCCGTATG
AAGGTGTCGACGGCCGACAAGACGGACCGACAGAACTTCTTCAAGGTCAACAAGGTCGATGTTGACTTCAAGGGG
CTCAATATCAAGCTCAAGCAGTCGCATCACAAGTTCCTCTTTGCCCTCGTCAAGCCTTTGATGCTCACCATCCTG
CGCCCCCCGATCCAGAAGGCGGTGGAGAAGGCCATCAAGGACCAGTGCAACAATCTGGACGCCGAGATGTATCAG
ATCAAGCAGGAGGCCGACCGCGCCGCCAAGGAAGGACAGACGGATGCGGAGAAGCAGGAGAACTTCTACACGCGC
TACTACCAGGCAGCACAGAAGCGTTTCCTCGATGGCAAGGAGAAGAAGAAGGAGGAAGCCAAGGACAAGGTAGAC
GACAAGAAGGTCAACGTGGCCATGACGATGGAAGACAGCATCCTGCCCGATGTGAAGCTGCCGGGCGGCGTGAGC
ATCAAGGCCACCGAGTACAAGGAGCTGGCGCGCAAGGGCGAGAAGTGGGAGAGTCCCGTCTTCTCCATCGGCAGC
GCCAAGAAGAGCACCAACGTTCCGGCTGCGCCACGCATCGAGAAGAAGACGCGACCGCCACCGAGCACGACGAAT
GGACGTTCGGCGGCGGCGGCTGCGGTCAATGGCAAGGCGCCCGTCACGGCCAATGCCAACGTGCCCGGCCAGTCG
CACCTCAGCGCCTAC
Transcript >Ophio5|3447
ATGGCTGCCAACGTGAACAAGCCCACCGACTCCAAGCAGAAGGAGGCCGATATCAACCGGAAGCTCCAGCTGTAC
GGCATCTTCAGTGCCTTTCAGCTCGGCAAGGTGCCTTCGAATGACCAAATCGATGTCGCCCTCAACAGCTTTCTC
GCCTCCAAGGCGCTCAGCGAACCCGACCCGAAGCTGTCCGACGATGGGAAGCTACTTGTCAAGGATACGCGCGAA
ATGATTCAAAAGGCCCAGCACCTTCTCCTGTCCAAGAACGAGGGCAACTTGGTCCAAGACTTTATTTGGCAAACT
ACGCAGTTTGACACCAAGAGCATCCACGGACCTGACCGTCCCATCGATAAGGACAGTTTCAAGCGCGATGGCGAC
GAGACGCTCAAGGGTCTGAGGACGCTCGGCACACTGCTCATTACGAATGGCCAGTTCCGCAAGCTCCTCAAGGAT
GCCTCTGTCCTCCTCCGCGACATGGCCGGTGATGCCGCTAGCAACGCCGCGACTTTCGTCCGCCCCTCTGAGGAT
CAGCTTGCCCAGATGGACACTGCGGCACCTGACAACACGTGGTACGACGCTCCCGATCTCTCCAAGGACAGCTTG
AAGAAGCAGGCCCAGAACATCTACGGCGGAAGCGCCAAGAAGGATGCCAAGGACGTCGCGTCATCGGCTGCCAAC
GCCGCTGGCTCCACGGACCCCAGGGCTGCCGACAAGACGGCCGGGCAGAACGCCGTCCTCTCCGCAGCCAAGAGC
AAGATCGATCAGAACCTTGACCCGGAGACGAAGGAGAAGATCAAGAAGCGCAATGAAGAGTATCGCCTCAAGGCT
AAGGAATACTTCAATAAGAAGATGCCGCAGGAGCGCAAGGACCAGATCATCTTCCGTCTGAAGAAGATGATCCTC
GAGTGCCAGCAACACCAGGACTACTCGGAAGCTATTCAGACTCTACTCAGGCTCGCCGAGACGTATGGCCGCCAC
GGTCGCTCCATGGGCGAGGGATCGGCCGGCTCGGCCAAAAAGGCTCGGTCCGGCTTCGCTGCCGCCGAGAACGAT
TTGCGCACTCTCATCGAGCGCTTCGCTAATGGCACCTCGACGGCTGAACTTTGGGCGACCATCCGCCAGATGTAC
GAGGCCGCTGACAAGGATTCGGAGCTCAAGGGCTGGTTCAAGAGCATGAACAGTTACATCCGCCGCTGCTTGCTC
GAGCAGGGCTACATTCTCGAAGAGTCGTCGACGAGGGAGTGGGACCGTCTCTACGAGCATGGCAGGTTCCTCCTC
CGTGACAAGTATCGTCATCAGACGGATCAGGTCATCGACGAAGTCAAGTTCATCGGCGACCAATTCGATCAGGAT
GTGCACAATAAGGCCTTTGGCAACTCGGTCCAGAAGCTCGTCAACCACCTGGGTCAGGATTCCCAGGGCAAGGCC
GCCTTCAAGCCGCACCTGCTGAAGGATCTCGGCGAGGTGATTTTGCCCAGCCTCCTGCAGAACATCAACTACATC
CCCATTCCGCGCATCGAGTACGTGGATCCTCAGTTCGAGGTCGCCATTGAGAACTTGGTGCTCGAGAGCGACAAC
TTCATGCCCAACGTGTTTGAAATCGCCAGCGAGAACTTCTTCCGTTGGGGCCGCAAGAACCTCGGCAGCAAGAAT
CACAACATGATTGACGTCAAGGTTGCTGGCATCCAGATGGACCTCCGCGATGTCAGTTACTATGTGAAGCGCAAG
GCTGGCTTCCCCGCCATCAGCGACTTGGGCGTGGCCGACATCCTCCTCCCCGGCAACGGCTTGTCGTTCCGTATG
AAGGTGTCGACGGCCGACAAGACGGACCGACAGAACTTCTTCAAGGTCAACAAGGTCGATGTTGACTTCAAGGGG
CTCAATATCAAGCTCAAGCAGTCGCATCACAAGTTCCTCTTTGCCCTCGTCAAGCCTTTGATGCTCACCATCCTG
CGCCCCCCGATCCAGAAGGCGGTGGAGAAGGCCATCAAGGACCAGTGCAACAATCTGGACGCCGAGATGTATCAG
ATCAAGCAGGAGGCCGACCGCGCCGCCAAGGAAGGACAGACGGATGCGGAGAAGCAGGAGAACTTCTACACGCGC
TACTACCAGGCAGCACAGAAGCGTTTCCTCGATGGCAAGGAGAAGAAGAAGGAGGAAGCCAAGGACAAGGTAGAC
GACAAGAAGGTCAACGTGGCCATGACGATGGAAGACAGCATCCTGCCCGATGTGAAGCTGCCGGGCGGCGTGAGC
ATCAAGGCCACCGAGTACAAGGAGCTGGCGCGCAAGGGCGAGAAGTGGGAGAGTCCCGTCTTCTCCATCGGCAGC
GCCAAGAAGAGCACCAACGTTCCGGCTGCGCCACGCATCGAGAAGAAGACGCGACCGCCACCGAGCACGACGAAT
GGACGTTCGGCGGCGGCGGCTGCGGTCAATGGCAAGGCGCCCGTCACGGCCAATGCCAACGTGCCCGGCCAGTCG
CACCTCAGCGCCTACTAG
Gene >Ophio5|3447
ATGGCTGCCAACGTGAACAAGCCCACCGACTCCAAGCAGAAGGAGGCCGATATCAACCGGAAGCTCCAGCTGTAC
GGCATCTTCAGTGCCTTTCAGCTCGGCAAGGTGCCTTCGGTGCGTCTGCTCCTCCTCCCGCTACAGCCATCCTTT
CCATGGCTAACCAGACTGTCGCAGAATGACCAAATCGATGTCGCCCTCAACAGCTTTCTCGCCTCCAAGGCGCTC
AGCGAACCCGACCCGAAGCTGTCCGACGATGGGAAGCTACTTGTCAAGGATACGCGCGAAATGATTCAAAAGGCC
CAGCACCTTCTCCTGTCCAAGAACGAGGGCAACTTGGTCCAAGACTTTATTTGGCAAACTACGCAGTTTGACACC
AAGAGCATCCACGGACCTGACCGTCCCATCGATAAGGACAGTTTCAAGCGCGATGGCGACGAGACGCTCAAGGGT
CTGAGGACGCTCGGCACACTGCTCATTACGAATGGCCAGTTCCGCAAGCTCCGTAAGTCAATTATGCACCGTTAC
TCACGTCCTGTCCCTAACCATGTCCCTCAGTCAAGGATGCCTCTGTCCTCCTCCGCGACATGGCCGGTGATGCCG
CTAGCAACGCCGCGACTTTCGTCCGCCCCTCTGAGGATCAGCTTGCCCAGATGGACACTGCGGCACCTGACAACA
CGTGGTACGACGCTCCCGATCTCTCCAAGGACAGCTTGAAGAAGCAGGCCCAGAACATCTACGGCGGAAGCGCCA
AGAAGGATGCCAAGGACGTCGCGTCATCGGCTGCCAACGCCGCTGGCTCCACGGACCCCAGGGCTGCCGACAAGA
CGGCCGGGCAGAACGCCGTCCTCTCCGCAGCCAAGAGCAAGATCGATCAGAACCTTGACCCGGAGACGAAGGAGA
AGATCAAGAAGCGCAATGAAGAGTATCGCCTCAAGGCTAAGGAATACTTCAATAAGAAGATGCCGCAGGAGCGCA
AGGACCAGATCATCTTCCGTCTGAAGAAGATGATCCTCGAGTGCCAGCAACACCAGGACTACTCGGAAGCTATTC
AGACTCTACTCAGGCTCGCCGAGACGTATGGCCGCCACGGTCGCTCCATGGGCGAGGGATCGGCCGGCTCGGCCA
AAAAGGCTCGGTCCGGCTTCGCTGCCGCCGAGAACGATTTGCGCACTCTCATCGAGCGCTTCGCTAATGGCACCT
CGACGGCTGAACTTTGGGCGACCATCCGCCAGATGTACGAGGCCGCTGACAAGGATTCGGAGCTCAAGGGCTGGT
TCAAGAGCATGAACAGTTACATCCGCCGCTGCTTGCTCGAGCAGGGCTACATTCTCGAAGAGTCGTCGACGAGGG
AGTGGGACCGTCTCTACGAGCATGGCAGGTTCCTCCTCCGTGACAAGTATCGTCATCAGACGGATCAGGTCATCG
ACGAAGTCAAGTTCATCGGCGACCAATTCGATCAGGATGTGCACAATAAGGCCTTTGGCAACTCGGTCCAGAAGC
TCGTCAACCACCTGGGTCAGGATTCCCAGGGCAAGGCCGCCTTCAAGCCGCACCTGCTGAAGGATCTCGGCGAGG
TGATTTTGCCCAGCCTCCTGCAGAACATCAACTACATCCCCATTCCGCGCATCGAGTACGTGGATCCTCAGTTCG
AGGTCGCCATTGAGAACTTGGTGCTCGAGAGCGACAACTTCATGCCCAACGTGTTTGAAATCGCCAGCGAGAACT
TCTTCCGTTGGGGCCGCAAGAACCTCGGCAGCAAGAATCACAACATGATTGACGTCAAGGTTGCTGGCATCCAGA
TGGACCTCCGCGATGTCAGTTACTATGTGAAGCGCAAGGCTGGCTTCCCCGCCATCAGCGACTTGGGCGTGGCCG
ACATCCTCCTCCCCGGCAACGGCTTGTCGTTCCGTATGAAGGTGTCGACGGCCGACAAGACGGACCGACAGAACT
TCTTCAAGGTCAACAAGGTCGATGTTGACTTCAAGGGGCTCAATATCAAGCTCAAGCAGTCGCATCACAAGTTCC
TCTTTGCCCTCGTCAAGCCTTTGATGCTCACCATCCTGCGCCCCCCGATCCAGAAGGCGGTGGAGAAGGCCATCA
AGGACCAGTGCAACAATCTGGACGCCGAGATGTATCAGATCAAGCAGGAGGCCGACCGCGCCGCCAAGGAAGGAC
AGACGGATGCGGAGAAGCAGGAGAACTTCTACACGCGCTACTACCAGGCAGCACAGAAGCGTTTCCTCGATGGCA
AGGAGAAGAAGAAGGAGGAAGCCAAGGACAAGGTAGACGACAAGAAGGTCAACGTGGCCATGACGATGGAAGACA
GCATCCTGCCCGATGTGAAGCTGCCGGGCGGCGTGAGCATCAAGGCCACCGAGTACAAGGAGCTGGCGCGCAAGG
GCGAGAAGTGGGAGAGTCCCGTCTTCTCCATCGGCAGCGCCAAGAAGAGCACCAACGTTCCGGCTGCGCCACGCA
TCGAGAAGAAGACGCGACCGCCACCGAGCACGACGAATGGACGTTCGGCGGCGGCGGCTGCGGTCAATGGCAAGG
CGCCCGTCACGGCCAATGCCAACGTGCCCGGCCAGTCGCACCTCAGCGCCTACTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail