Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3437
Gene name
Locationscaffold_272:13435..14728
Strand-
Gene length (bp)1293
Transcript length (bp)1176
Coding sequence length (bp)1173
Protein length (aa) 391

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF18376 MDD_C Mevalonate 5-diphosphate decarboxylase C-terminal domain 6.2E-61 198 375
PF00288 GHMP_kinases_N GHMP kinases N terminal domain 9.0E-08 109 167

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13963|MVD1_SCHPO Diphosphomevalonate decarboxylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mvd1 PE=3 SV=1 6 387 7.0E-141
sp|P32377|MVD1_YEAST Diphosphomevalonate decarboxylase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MVD1 PE=1 SV=2 6 382 7.0E-131
sp|Q751D8|MVD1_ASHGO Diphosphomevalonate decarboxylase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MVD1 PE=3 SV=2 6 382 1.0E-129
sp|Q6BY07|MVD1_DEBHA Diphosphomevalonate decarboxylase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=MVD1 PE=3 SV=2 6 386 3.0E-127
sp|Q0P570|MVD1_BOVIN Diphosphomevalonate decarboxylase OS=Bos taurus GN=MVD PE=2 SV=1 5 386 9.0E-99
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13963|MVD1_SCHPO Diphosphomevalonate decarboxylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mvd1 PE=3 SV=1 6 387 7.0E-141
sp|P32377|MVD1_YEAST Diphosphomevalonate decarboxylase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MVD1 PE=1 SV=2 6 382 7.0E-131
sp|Q751D8|MVD1_ASHGO Diphosphomevalonate decarboxylase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MVD1 PE=3 SV=2 6 382 1.0E-129
sp|Q6BY07|MVD1_DEBHA Diphosphomevalonate decarboxylase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=MVD1 PE=3 SV=2 6 386 3.0E-127
sp|Q0P570|MVD1_BOVIN Diphosphomevalonate decarboxylase OS=Bos taurus GN=MVD PE=2 SV=1 5 386 9.0E-99
sp|Q99JF5|MVD1_MOUSE Diphosphomevalonate decarboxylase OS=Mus musculus GN=Mvd PE=1 SV=2 12 386 2.0E-97
sp|Q62967|MVD1_RAT Diphosphomevalonate decarboxylase OS=Rattus norvegicus GN=Mvd PE=1 SV=1 12 386 8.0E-97
sp|P53602|MVD1_HUMAN Diphosphomevalonate decarboxylase OS=Homo sapiens GN=MVD PE=1 SV=1 5 386 2.0E-96
sp|Q5U403|MVD1_DANRE Diphosphomevalonate decarboxylase OS=Danio rerio GN=mvd PE=2 SV=1 9 386 8.0E-95
sp|Q54YQ9|MVD1_DICDI Diphosphomevalonate decarboxylase OS=Dictyostelium discoideum GN=mvd PE=3 SV=1 12 374 2.0E-88
sp|Q97UL5|DMD_SULSO Diphosphomevalonate decarboxylase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=SSO2989 PE=1 SV=1 9 374 2.0E-57
sp|D4GXZ3|PMD_HALVD Phosphomevalonate decarboxylase OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=mvaD PE=1 SV=1 19 354 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0017076 purine nucleotide binding No
GO:0030554 adenyl nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0043168 anion binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0032553 ribonucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032555 purine ribonucleotide binding No
GO:0000166 nucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0097367 carbohydrate derivative binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No
GO:0036094 small molecule binding No
GO:0032559 adenyl ribonucleotide binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Peroxisomal targeting signal 0.7372 0.5914 0.0293 0.0852 0.1587 0.0301 0.153 0.0648 0.0693 0.5059

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1206
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5071
Ophiocordyceps australis map64 (Brazil) OphauB2|2093
Ophiocordyceps camponoti-floridani Ophcf2|05157
Ophiocordyceps camponoti-rufipedis Ophun1|5399
Ophiocordyceps kimflemingae Ophio5|3437 (this protein)
Ophiocordyceps subramaniannii Hirsu2|10365

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3437
MASIPVYRASTTAPVNIAVVKYWGKRDARLNLPTNSSLSVTLSQADLRTLTTASCSDSFADGDSLTLNGEPTDVS
GARIQACFWELRARRAKLEATDPLLPRLSTMALRIVSENNFPTAAGLASSAAGFAALVRAVADLYCLPDSPELLS
IVARRGSGSACRSLMGGYVAWRAGDREDGLDSLAEMIAPASHWPEMRALILVVSAAKKGVSSTAGMQQTVATSGL
FTQRISTVASANMAAMEQAVKARDFDEFAKVTMMESNSFHACCLDTYPPIFYLNDVSRAAIRAVEAINAAAGTTV
AAYTFDAGPNCVVYYVEKDASTVVGTFSDVLGHVDGWKEGCEGGASTIKLDEGMAHVLRDGVSRVIMTAVGEGPA
PSDEHLVAEDGQRLCR
Coding >Ophio5|3437
ATGGCCTCTATCCCCGTCTATCGAGCCAGCACGACGGCGCCCGTCAACATCGCCGTGGTCAAATACTGGGGCAAA
CGCGATGCCAGACTCAACCTCCCGACCAACAGCTCCCTATCCGTCACGCTCTCGCAGGCCGACCTGCGCACGCTG
ACGACGGCCTCGTGCTCGGACTCGTTCGCCGACGGCGATAGCCTGACGCTTAATGGCGAGCCGACCGACGTATCG
GGCGCGCGGATCCAGGCCTGCTTCTGGGAGCTGCGTGCGCGTCGAGCCAAGCTGGAGGCGACGGATCCTTTGCTG
CCGCGGCTGTCGACTATGGCGCTGCGCATCGTGTCGGAGAATAACTTCCCCACGGCCGCGGGGCTGGCGTCGTCG
GCCGCCGGCTTTGCAGCCCTCGTACGCGCCGTTGCGGACCTGTATTGCCTGCCGGATTCGCCCGAACTGCTCAGT
ATCGTCGCCCGCCGGGGTTCCGGGTCGGCCTGCAGGAGTCTGATGGGCGGCTACGTTGCCTGGCGCGCGGGCGAT
AGGGAAGACGGCCTTGACTCCCTCGCTGAGATGATTGCGCCCGCGTCGCACTGGCCCGAAATGCGGGCTCTCATA
CTCGTCGTCAGCGCCGCCAAAAAGGGCGTATCGTCTACGGCCGGCATGCAGCAGACGGTCGCAACCTCGGGCCTC
TTCACCCAGAGGATATCGACCGTCGCGTCGGCCAACATGGCGGCCATGGAGCAGGCCGTCAAGGCTAGAGACTTT
GACGAATTTGCCAAGGTGACCATGATGGAGTCCAACTCGTTCCACGCCTGTTGCCTCGACACATACCCGCCCATC
TTTTATCTCAATGACGTCTCCAGGGCTGCCATTCGAGCCGTCGAGGCCATCAACGCCGCTGCCGGAACGACGGTT
GCGGCCTACACCTTCGACGCCGGACCCAACTGCGTCGTCTACTACGTCGAAAAGGATGCCTCGACCGTGGTGGGG
ACCTTTTCCGACGTGCTGGGCCACGTGGATGGCTGGAAGGAGGGCTGTGAAGGGGGTGCGTCGACGATCAAGCTG
GACGAGGGCATGGCGCATGTGCTGAGGGATGGAGTCAGTAGAGTCATTATGACGGCTGTTGGTGAAGGGCCGGCT
CCGTCAGATGAGCACCTGGTGGCCGAGGATGGCCAGCGGCTGTGTCGA
Transcript >Ophio5|3437
ATGGCCTCTATCCCCGTCTATCGAGCCAGCACGACGGCGCCCGTCAACATCGCCGTGGTCAAATACTGGGGCAAA
CGCGATGCCAGACTCAACCTCCCGACCAACAGCTCCCTATCCGTCACGCTCTCGCAGGCCGACCTGCGCACGCTG
ACGACGGCCTCGTGCTCGGACTCGTTCGCCGACGGCGATAGCCTGACGCTTAATGGCGAGCCGACCGACGTATCG
GGCGCGCGGATCCAGGCCTGCTTCTGGGAGCTGCGTGCGCGTCGAGCCAAGCTGGAGGCGACGGATCCTTTGCTG
CCGCGGCTGTCGACTATGGCGCTGCGCATCGTGTCGGAGAATAACTTCCCCACGGCCGCGGGGCTGGCGTCGTCG
GCCGCCGGCTTTGCAGCCCTCGTACGCGCCGTTGCGGACCTGTATTGCCTGCCGGATTCGCCCGAACTGCTCAGT
ATCGTCGCCCGCCGGGGTTCCGGGTCGGCCTGCAGGAGTCTGATGGGCGGCTACGTTGCCTGGCGCGCGGGCGAT
AGGGAAGACGGCCTTGACTCCCTCGCTGAGATGATTGCGCCCGCGTCGCACTGGCCCGAAATGCGGGCTCTCATA
CTCGTCGTCAGCGCCGCCAAAAAGGGCGTATCGTCTACGGCCGGCATGCAGCAGACGGTCGCAACCTCGGGCCTC
TTCACCCAGAGGATATCGACCGTCGCGTCGGCCAACATGGCGGCCATGGAGCAGGCCGTCAAGGCTAGAGACTTT
GACGAATTTGCCAAGGTGACCATGATGGAGTCCAACTCGTTCCACGCCTGTTGCCTCGACACATACCCGCCCATC
TTTTATCTCAATGACGTCTCCAGGGCTGCCATTCGAGCCGTCGAGGCCATCAACGCCGCTGCCGGAACGACGGTT
GCGGCCTACACCTTCGACGCCGGACCCAACTGCGTCGTCTACTACGTCGAAAAGGATGCCTCGACCGTGGTGGGG
ACCTTTTCCGACGTGCTGGGCCACGTGGATGGCTGGAAGGAGGGCTGTGAAGGGGGTGCGTCGACGATCAAGCTG
GACGAGGGCATGGCGCATGTGCTGAGGGATGGAGTCAGTAGAGTCATTATGACGGCTGTTGGTGAAGGGCCGGCT
CCGTCAGATGAGCACCTGGTGGCCGAGGATGGCCAGCGGCTGTGTCGATGA
Gene >Ophio5|3437
ATGGCCTCTATCCCCGTCTATCGAGCCAGCACGACGGCGCCCGTCAACATCGCCGTGGTCAAGTTGCGTCTTTCC
GCGCTTCCCCCCCTCTGACTACGGCTCTGTCTCCCTCTTATCTCTGTCTCCCTCCCTCTTCGTCTCTCTCCCTCT
CCGTCTGACGTTATCGCACATCATCACAGATACTGGGGCAAACGCGATGCCAGACTCAACCTCCCGACCAACAGC
TCCCTATCCGTCACGCTCTCGCAGGCCGACCTGCGCACGCTGACGACGGCCTCGTGCTCGGACTCGTTCGCCGAC
GGCGATAGCCTGACGCTTAATGGCGAGCCGACCGACGTATCGGGCGCGCGGATCCAGGCCTGCTTCTGGGAGCTG
CGTGCGCGTCGAGCCAAGCTGGAGGCGACGGATCCTTTGCTGCCGCGGCTGTCGACTATGGCGCTGCGCATCGTG
TCGGAGAATAACTTCCCCACGGCCGCGGGGCTGGCGTCGTCGGCCGCCGGCTTTGCAGCCCTCGTACGCGCCGTT
GCGGACCTGTATTGCCTGCCGGATTCGCCCGAACTGCTCAGTATCGTCGCCCGCCGGGGTTCCGGGTCGGCCTGC
AGGAGTCTGATGGGCGGCTACGTTGCCTGGCGCGCGGGCGATAGGGAAGACGGCCTTGACTCCCTCGCTGAGATG
ATTGCGCCCGCGTCGCACTGGCCCGAAATGCGGGCTCTCATACTCGTCGTCAGCGCCGCCAAAAAGGGCGTATCG
TCTACGGCCGGCATGCAGCAGACGGTCGCAACCTCGGGCCTCTTCACCCAGAGGATATCGACCGTCGCGTCGGCC
AACATGGCGGCCATGGAGCAGGCCGTCAAGGCTAGAGACTTTGACGAATTTGCCAAGGTGACCATGATGGAGTCC
AACTCGTTCCACGCCTGTTGCCTCGACACATACCCGCCCATCTTTTATCTCAATGACGTCTCCAGGGCTGCCATT
CGAGCCGTCGAGGCCATCAACGCCGCTGCCGGAACGACGGTTGCGGCCTACACCTTCGACGCCGGACCCAACTGC
GTCGTCTACTACGTCGAAAAGGATGCCTCGACCGTGGTGGGGACCTTTTCCGACGTGCTGGGCCACGTGGATGGC
TGGAAGGAGGGCTGTGAAGGGGGTGCGTCGACGATCAAGCTGGACGAGGGCATGGCGCATGTGCTGAGGGATGGA
GTCAGTAGAGTCATTATGACGGCTGTTGGTGAAGGGCCGGCTCCGTCAGATGAGCACCTGGTGGCCGAGGATGGC
CAGCGGCTGTGTCGATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail