Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3436
Gene name
Locationscaffold_272:11687..13165
Strand-
Gene length (bp)1478
Transcript length (bp)1413
Coding sequence length (bp)1410
Protein length (aa) 470

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04884 UVB_sens_prot Vitamin B6 photo-protection and homoeostasis 1.5E-85 73 309

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q86K80|RUS1_DICDI RUS1 family protein homolog OS=Dictyostelium discoideum GN=DDB_G0277179 PE=3 SV=1 75 326 1.0E-51
sp|Q84JB8|RUS3_ARATH Protein root UVB sensitive 3 OS=Arabidopsis thaliana GN=RUS3 PE=2 SV=1 76 339 3.0E-46
sp|Q499P8|RUS1_RAT RUS1 family protein C16orf58 homolog OS=Rattus norvegicus PE=2 SV=1 70 330 2.0E-43
sp|Q91W34|RUS1_MOUSE RUS1 family protein C16orf58 homolog OS=Mus musculus PE=1 SV=1 84 330 3.0E-42
sp|Q5R8F6|RUS1_PONAB RUS1 family protein C16orf58 homolog OS=Pongo abelii PE=2 SV=1 84 330 4.0E-39
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q86K80|RUS1_DICDI RUS1 family protein homolog OS=Dictyostelium discoideum GN=DDB_G0277179 PE=3 SV=1 75 326 1.0E-51
sp|Q84JB8|RUS3_ARATH Protein root UVB sensitive 3 OS=Arabidopsis thaliana GN=RUS3 PE=2 SV=1 76 339 3.0E-46
sp|Q499P8|RUS1_RAT RUS1 family protein C16orf58 homolog OS=Rattus norvegicus PE=2 SV=1 70 330 2.0E-43
sp|Q91W34|RUS1_MOUSE RUS1 family protein C16orf58 homolog OS=Mus musculus PE=1 SV=1 84 330 3.0E-42
sp|Q5R8F6|RUS1_PONAB RUS1 family protein C16orf58 homolog OS=Pongo abelii PE=2 SV=1 84 330 4.0E-39
sp|Q96GQ5|RUS1_HUMAN RUS1 family protein C16orf58 OS=Homo sapiens GN=C16orf58 PE=1 SV=2 84 330 1.0E-38
sp|Q7X6P3|RUS1_ARATH Protein root UVB sensitive 1, chloroplastic OS=Arabidopsis thaliana GN=RUS1 PE=1 SV=1 77 322 9.0E-21
sp|Q9SJX7|RUS2_ARATH Protein root UVB sensitive 2, chloroplastic OS=Arabidopsis thaliana GN=RUS2 PE=1 SV=2 36 336 1.0E-19
sp|B6IDH3|RUS5_ARATH Protein root UVB sensitive 5 OS=Arabidopsis thaliana GN=RUS5 PE=2 SV=1 79 332 2.0E-16
sp|Q93YU2|RUS6_ARATH Protein root UVB sensitive 6 OS=Arabidopsis thaliana GN=RUS6 PE=2 SV=1 85 325 2.0E-14
sp|Q67YT8|RUS4_ARATH Protein root UVB sensitive 4 OS=Arabidopsis thaliana GN=RUS4 PE=2 SV=1 76 324 9.0E-11
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3436
MPRQRRFDGDSFKLAISDDNHRQGFAHLVRSGYDIDVVELSKSGHDPKHWKHSASGLVVRIQLRSQGMVMRSLRG
WRKMMMDAFLPVDFPNSVSSDYLAYQMYDSLQAFFSTITSLLASRALLQGLGVGDANSSATFAMLLTIMRNAVSN
VVTIIFAHRFGLSIEPEAKKYRFLADLFNDSAFFLELYSPHLGSWTKAIALCSAEGLRAVCGVAAGASKAALSLH
FAKNDNLSELSAKEASQETAVSLVGLLVGTVVVRAVQDHSLVVYLVVALSLAHLWTNYRGVRSVCMTSINKQRAT
ILFYAYMSSSMVLTPQQVAESERIIFWDGLMRNASHEPVLLISYAKNFGDAMSKGAKDVVAVDGPMHTSFIRPYA
PGRPGNIKILLWDGAEPKHAILAWFMAMDTARATTTDNPYGNNDEVSVAAKWRPRARDDLLWTNLEAQGWDLDTG
AMETGPGVRLSVEMSGRKDE
Coding >Ophio5|3436
ATGCCTCGCCAACGTCGATTCGATGGCGATAGCTTCAAGCTCGCCATTTCAGACGATAACCACCGTCAAGGCTTC
GCCCATCTCGTCCGCTCCGGTTACGACATCGACGTCGTCGAGCTCTCCAAATCAGGCCACGACCCCAAGCACTGG
AAGCACTCGGCCTCGGGTCTCGTCGTCCGCATCCAACTCCGGAGCCAAGGCATGGTGATGCGCTCGCTGCGTGGC
TGGCGCAAGATGATGATGGATGCTTTCCTGCCCGTCGACTTCCCCAACTCGGTTTCGAGCGACTATCTCGCCTAT
CAGATGTACGACTCGCTGCAGGCTTTCTTCTCCACCATCACGTCGCTGCTTGCCAGTCGTGCTTTGCTCCAGGGC
TTGGGCGTCGGAGATGCGAACTCGTCGGCTACGTTTGCCATGCTTCTCACCATCATGCGCAATGCCGTGTCCAAC
GTCGTCACCATCATCTTTGCTCATCGATTCGGCTTGAGCATCGAGCCCGAGGCGAAAAAGTATCGCTTCCTCGCT
GACCTCTTCAACGACTCGGCTTTCTTCCTTGAGCTCTATAGCCCCCATCTCGGATCCTGGACCAAGGCCATCGCT
CTTTGCTCCGCTGAGGGACTGCGTGCCGTCTGTGGCGTCGCCGCCGGTGCCAGCAAGGCCGCTCTAAGCCTGCAC
TTTGCCAAGAACGATAACCTGTCGGAGCTGAGCGCCAAGGAGGCCAGCCAGGAGACGGCCGTCAGCCTCGTCGGC
CTGCTCGTCGGTACCGTCGTCGTCCGCGCCGTGCAGGACCACAGCCTCGTCGTCTACCTGGTCGTGGCGCTCTCC
CTCGCCCATCTATGGACCAACTACCGCGGCGTGCGTAGCGTCTGCATGACGTCCATCAACAAGCAGCGTGCCACG
ATCCTCTTTTACGCCTACATGTCGTCGTCTATGGTCCTCACTCCGCAGCAGGTGGCCGAGAGCGAACGCATCATC
TTCTGGGACGGTCTGATGCGCAACGCCAGCCATGAACCCGTCTTGCTCATCAGTTATGCCAAGAACTTTGGTGAC
GCCATGAGCAAAGGCGCCAAAGACGTCGTCGCCGTAGACGGCCCCATGCACACAAGCTTCATTCGTCCCTACGCG
CCGGGCCGACCCGGAAACATCAAGATTCTTCTCTGGGACGGCGCCGAGCCGAAGCACGCCATCCTCGCCTGGTTC
ATGGCCATGGATACGGCTCGGGCGACCACGACGGACAACCCGTATGGGAACAACGACGAAGTGAGTGTCGCAGCG
AAATGGCGGCCTCGCGCCCGGGATGACTTGCTGTGGACGAACTTGGAGGCCCAGGGATGGGATTTGGACACGGGC
GCCATGGAGACGGGGCCGGGCGTCCGGCTCAGCGTTGAAATGTCCGGCCGCAAGGACGAA
Transcript >Ophio5|3436
ATGCCTCGCCAACGTCGATTCGATGGCGATAGCTTCAAGCTCGCCATTTCAGACGATAACCACCGTCAAGGCTTC
GCCCATCTCGTCCGCTCCGGTTACGACATCGACGTCGTCGAGCTCTCCAAATCAGGCCACGACCCCAAGCACTGG
AAGCACTCGGCCTCGGGTCTCGTCGTCCGCATCCAACTCCGGAGCCAAGGCATGGTGATGCGCTCGCTGCGTGGC
TGGCGCAAGATGATGATGGATGCTTTCCTGCCCGTCGACTTCCCCAACTCGGTTTCGAGCGACTATCTCGCCTAT
CAGATGTACGACTCGCTGCAGGCTTTCTTCTCCACCATCACGTCGCTGCTTGCCAGTCGTGCTTTGCTCCAGGGC
TTGGGCGTCGGAGATGCGAACTCGTCGGCTACGTTTGCCATGCTTCTCACCATCATGCGCAATGCCGTGTCCAAC
GTCGTCACCATCATCTTTGCTCATCGATTCGGCTTGAGCATCGAGCCCGAGGCGAAAAAGTATCGCTTCCTCGCT
GACCTCTTCAACGACTCGGCTTTCTTCCTTGAGCTCTATAGCCCCCATCTCGGATCCTGGACCAAGGCCATCGCT
CTTTGCTCCGCTGAGGGACTGCGTGCCGTCTGTGGCGTCGCCGCCGGTGCCAGCAAGGCCGCTCTAAGCCTGCAC
TTTGCCAAGAACGATAACCTGTCGGAGCTGAGCGCCAAGGAGGCCAGCCAGGAGACGGCCGTCAGCCTCGTCGGC
CTGCTCGTCGGTACCGTCGTCGTCCGCGCCGTGCAGGACCACAGCCTCGTCGTCTACCTGGTCGTGGCGCTCTCC
CTCGCCCATCTATGGACCAACTACCGCGGCGTGCGTAGCGTCTGCATGACGTCCATCAACAAGCAGCGTGCCACG
ATCCTCTTTTACGCCTACATGTCGTCGTCTATGGTCCTCACTCCGCAGCAGGTGGCCGAGAGCGAACGCATCATC
TTCTGGGACGGTCTGATGCGCAACGCCAGCCATGAACCCGTCTTGCTCATCAGTTATGCCAAGAACTTTGGTGAC
GCCATGAGCAAAGGCGCCAAAGACGTCGTCGCCGTAGACGGCCCCATGCACACAAGCTTCATTCGTCCCTACGCG
CCGGGCCGACCCGGAAACATCAAGATTCTTCTCTGGGACGGCGCCGAGCCGAAGCACGCCATCCTCGCCTGGTTC
ATGGCCATGGATACGGCTCGGGCGACCACGACGGACAACCCGTATGGGAACAACGACGAAGTGAGTGTCGCAGCG
AAATGGCGGCCTCGCGCCCGGGATGACTTGCTGTGGACGAACTTGGAGGCCCAGGGATGGGATTTGGACACGGGC
GCCATGGAGACGGGGCCGGGCGTCCGGCTCAGCGTTGAAATGTCCGGCCGCAAGGACGAATAG
Gene >Ophio5|3436
ATGCCTCGCCAACGTCGATTCGATGGCGATAGCTTCAAGCTCGCCATTTCAGACGATAACCACCGTCAAGGCTTC
GCCCATCTCGTCCGCTCCGGTTACGACATCGACGTCGTCGAGCTCTCCAAATCAGGCCACGACCCCAAGCACTGG
AAGCACTCGGCCTCGGGTCTCGTCGTCCGCGTCAGTTTGATCGTCTCGCTCGGTCTTTGTAGCCACCGAGCACTC
CGCTCACGTGCTTGACGCAGATCCAACTCCGGAGCCAAGGCATGGTGATGCGCTCGCTGCGTGGCTGGCGCAAGA
TGATGATGGATGCTTTCCTGCCCGTCGACTTCCCCAACTCGGTTTCGAGCGACTATCTCGCCTATCAGATGTACG
ACTCGCTGCAGGCTTTCTTCTCCACCATCACGTCGCTGCTTGCCAGTCGTGCTTTGCTCCAGGGCTTGGGCGTCG
GAGATGCGAACTCGTCGGCTACGTTTGCCATGCTTCTCACCATCATGCGCAATGCCGTGTCCAACGTCGTCACCA
TCATCTTTGCTCATCGATTCGGCTTGAGCATCGAGCCCGAGGCGAAAAAGTATCGCTTCCTCGCTGACCTCTTCA
ACGACTCGGCTTTCTTCCTTGAGCTCTATAGCCCCCATCTCGGATCCTGGACCAAGGCCATCGCTCTTTGCTCCG
CTGAGGGACTGCGTGCCGTCTGTGGCGTCGCCGCCGGTGCCAGCAAGGCCGCTCTAAGCCTGCACTTTGCCAAGA
ACGATAACCTGTCGGAGCTGAGCGCCAAGGAGGCCAGCCAGGAGACGGCCGTCAGCCTCGTCGGCCTGCTCGTCG
GTACCGTCGTCGTCCGCGCCGTGCAGGACCACAGCCTCGTCGTCTACCTGGTCGTGGCGCTCTCCCTCGCCCATC
TATGGACCAACTACCGCGGCGTGCGTAGCGTCTGCATGACGTCCATCAACAAGCAGCGTGCCACGATCCTCTTTT
ACGCCTACATGTCGTCGTCTATGGTCCTCACTCCGCAGCAGGTGGCCGAGAGCGAACGCATCATCTTCTGGGACG
GTCTGATGCGCAACGCCAGCCATGAACCCGTCTTGCTCATCAGTTATGCCAAGAACTTTGGTGACGCCATGAGCA
AAGGCGCCAAAGACGTCGTCGCCGTAGACGGCCCCATGCACACAAGCTTCATTCGTCCCTACGCGCCGGGCCGAC
CCGGAAACATCAAGATTCTTCTCTGGGACGGCGCCGAGCCGAAGCACGCCATCCTCGCCTGGTTCATGGCCATGG
ATACGGCTCGGGCGACCACGACGGACAACCCGTATGGGAACAACGACGAAGTGAGTGTCGCAGCGAAATGGCGGC
CTCGCGCCCGGGATGACTTGCTGTGGACGAACTTGGAGGCCCAGGGATGGGATTTGGACACGGGCGCCATGGAGA
CGGGGCCGGGCGTCCGGCTCAGCGTTGAAATGTCCGGCCGCAAGGACGAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail