Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3435
Gene name
Locationscaffold_272:10596..11442
Strand+
Gene length (bp)846
Transcript length (bp)762
Coding sequence length (bp)759
Protein length (aa) 253

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01265 Cyto_heme_lyase Cytochrome c/c1 heme lyase 8.7E-38 7 249

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13962|YE42_SCHPO Putative cytochrome c1 heme lyase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24C9.02c PE=3 SV=1 61 250 3.0E-51
sp|Q00873|CYT2_YEAST Cytochrome c1 heme lyase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CYT2 PE=3 SV=1 1 245 3.0E-43
sp|Q552W5|CCHL_DICDI Probable cytochrome c-type heme lyase OS=Dictyostelium discoideum GN=cchl PE=3 SV=1 66 249 4.0E-42
sp|A5PJG7|CCHL_BOVIN Cytochrome c-type heme lyase OS=Bos taurus GN=HCCS PE=2 SV=1 106 249 4.0E-35
sp|Q5F339|CCHL_CHICK Cytochrome c-type heme lyase OS=Gallus gallus GN=HCCS PE=2 SV=1 106 249 1.0E-34
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13962|YE42_SCHPO Putative cytochrome c1 heme lyase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24C9.02c PE=3 SV=1 61 250 3.0E-51
sp|Q00873|CYT2_YEAST Cytochrome c1 heme lyase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CYT2 PE=3 SV=1 1 245 3.0E-43
sp|Q552W5|CCHL_DICDI Probable cytochrome c-type heme lyase OS=Dictyostelium discoideum GN=cchl PE=3 SV=1 66 249 4.0E-42
sp|A5PJG7|CCHL_BOVIN Cytochrome c-type heme lyase OS=Bos taurus GN=HCCS PE=2 SV=1 106 249 4.0E-35
sp|Q5F339|CCHL_CHICK Cytochrome c-type heme lyase OS=Gallus gallus GN=HCCS PE=2 SV=1 106 249 1.0E-34
sp|P53701|CCHL_HUMAN Cytochrome c-type heme lyase OS=Homo sapiens GN=HCCS PE=1 SV=1 106 249 2.0E-34
sp|P53702|CCHL_MOUSE Cytochrome c-type heme lyase OS=Mus musculus GN=Hccs PE=1 SV=2 65 249 3.0E-34
sp|P53703|CCHL_CAEEL Probable cytochrome c-type heme lyase OS=Caenorhabditis elegans GN=cchl-1 PE=3 SV=1 109 237 3.0E-29
sp|P53700|CCHL_CANAW Cytochrome c heme lyase OS=Candida albicans (strain WO-1) GN=CYC3 PE=3 SV=2 64 251 3.0E-24
sp|P14187|CCHL_NEUCR Cytochrome c heme lyase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cyt-2 PE=3 SV=1 106 250 7.0E-24
sp|O74794|CCHL_SCHPO Putative cytochrome c heme lyase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC26H8.12 PE=3 SV=1 48 251 1.0E-22
sp|P06182|CCHL_YEAST Cytochrome c heme lyase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CYC3 PE=1 SV=1 104 249 4.0E-22
[Show less]

GO

GO Term Description Terminal node
GO:0005739 mitochondrion Yes
GO:0004408 holocytochrome-c synthase activity Yes
GO:0110165 cellular anatomical entity No
GO:0016829 lyase activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0043227 membrane-bounded organelle No
GO:0003824 catalytic activity No
GO:0005575 cellular_component No
GO:0043229 intracellular organelle No
GO:0003674 molecular_function No
GO:0043231 intracellular membrane-bounded organelle No
GO:0043226 organelle No
GO:0016846 carbon-sulfur lyase activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Lysosome/Vacuole Signal peptide 0.4202 0.0966 0.2336 0.2402 0.5321 0.0423 0.5813 0.5846 0.537 0.0906

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1208
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5069
Ophiocordyceps australis map64 (Brazil) OphauB2|2095
Ophiocordyceps camponoti-floridani Ophcf2|05159
Ophiocordyceps camponoti-rufipedis Ophun1|5401
Ophiocordyceps kimflemingae Ophio5|3435 (this protein)
Ophiocordyceps subramaniannii Hirsu2|10367

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3435
MAGGPDPSCPVDFKSRSVWLSLARAGEPTSAARPAPQTQSLTWAQTLASYLWTQAPSSARHDRELDTNRIVSSIP
RAVSASSWVAACPVEHGAAANAEAESGTAPDGNWVYPSEKMFFDAMRRKGYDARVADMKTVVPIHNAVNERAWAA
IRQWEEPYLQGSTSPGPKLESFSNKSDHMTPKARINTLLGYTAPFDRHDWVIDRCGTRVDYVIDFYAGRSDGKPG
PSFYLDVRPKLNTWEGVKMRALRWAYLA
Coding >Ophio5|3435
ATGGCCGGCGGCCCGGACCCTTCCTGTCCGGTTGACTTTAAGTCTCGCTCTGTCTGGCTTTCCCTCGCCCGCGCG
GGGGAGCCGACTTCGGCGGCACGTCCCGCACCCCAGACCCAGAGCCTGACCTGGGCCCAGACGCTGGCTTCATAC
CTATGGACCCAGGCGCCGTCGTCGGCTCGTCATGATAGAGAACTCGACACGAACCGTATCGTCTCTTCCATTCCG
CGGGCCGTTTCTGCATCGTCGTGGGTCGCTGCTTGTCCCGTGGAGCATGGCGCGGCGGCGAATGCTGAGGCCGAG
TCTGGAACCGCACCGGACGGCAATTGGGTGTACCCGTCTGAGAAGATGTTCTTCGACGCCATGCGCCGCAAGGGC
TACGATGCCCGTGTCGCGGACATGAAGACCGTCGTGCCTATTCACAACGCCGTCAACGAGCGCGCTTGGGCTGCG
ATCCGCCAGTGGGAGGAGCCCTACCTCCAAGGCTCGACCTCCCCCGGCCCGAAGCTCGAGTCCTTCTCCAATAAA
AGCGACCACATGACGCCCAAGGCGCGCATCAACACCCTTCTAGGCTACACGGCACCCTTCGATCGCCATGATTGG
GTTATTGACCGTTGCGGTACCCGTGTCGACTACGTCATCGACTTTTACGCCGGCCGCTCTGATGGCAAGCCCGGC
CCCAGCTTCTACCTCGACGTCAGGCCGAAGCTGAACACGTGGGAAGGCGTCAAAATGCGCGCTCTGAGATGGGCG
TATCTGGCT
Transcript >Ophio5|3435
ATGGCCGGCGGCCCGGACCCTTCCTGTCCGGTTGACTTTAAGTCTCGCTCTGTCTGGCTTTCCCTCGCCCGCGCG
GGGGAGCCGACTTCGGCGGCACGTCCCGCACCCCAGACCCAGAGCCTGACCTGGGCCCAGACGCTGGCTTCATAC
CTATGGACCCAGGCGCCGTCGTCGGCTCGTCATGATAGAGAACTCGACACGAACCGTATCGTCTCTTCCATTCCG
CGGGCCGTTTCTGCATCGTCGTGGGTCGCTGCTTGTCCCGTGGAGCATGGCGCGGCGGCGAATGCTGAGGCCGAG
TCTGGAACCGCACCGGACGGCAATTGGGTGTACCCGTCTGAGAAGATGTTCTTCGACGCCATGCGCCGCAAGGGC
TACGATGCCCGTGTCGCGGACATGAAGACCGTCGTGCCTATTCACAACGCCGTCAACGAGCGCGCTTGGGCTGCG
ATCCGCCAGTGGGAGGAGCCCTACCTCCAAGGCTCGACCTCCCCCGGCCCGAAGCTCGAGTCCTTCTCCAATAAA
AGCGACCACATGACGCCCAAGGCGCGCATCAACACCCTTCTAGGCTACACGGCACCCTTCGATCGCCATGATTGG
GTTATTGACCGTTGCGGTACCCGTGTCGACTACGTCATCGACTTTTACGCCGGCCGCTCTGATGGCAAGCCCGGC
CCCAGCTTCTACCTCGACGTCAGGCCGAAGCTGAACACGTGGGAAGGCGTCAAAATGCGCGCTCTGAGATGGGCG
TATCTGGCTTGA
Gene >Ophio5|3435
ATGGCCGGCGGCCCGGACCCTTCCTGTCCGGTTGACTTTAAGTCTCGCTCTGTCTGGCTTTCCCTCGCCCGCGCG
GGGGAGCCGACTTCGGCGGCACGTCCCGCACCCCAGACCCAGAGCCTGACCTGGGCCCAGACGCTGGCTTCATAC
CTATGGACCCAGGCGCCGTCGTCGGCTCGTCATGATAGAGAACTCGACACGAACCGTATCGTCTCTTCCATTCCG
CGGGCCGTTTCTGCATCGTCGTGGGTCGCTGCTTGTCCCGTGGAGCATGGCGCGGCGGCGAATGCTGAGGCCGAG
TCTGGAACCGCACCGGACGGCAATTGGGTGTACCCGTCTGAGAAGATGTTCTTCGACGCCATGCGCCGCAAGGGC
TACGATGCCCGTGTCGCGGACATGAAGACCGTCGTGCCTATTCACAACGCCGTCAACGAGCGCGCTTGGGCTGCG
ATCCGCCAGTGGGAGGAGCCCTACCTCCAAGGCTCGACGTCTGTCTCATCCCGCGCCAACTGCTGTCTCCTGGCG
GTTATAGTAAAAAAAAAAAAAGAGGAATTTTGCTGACTGCTTCGCAGCTCCCCCGGCCCGAAGCTCGAGTCCTTC
TCCAATAAAAGCGACCACATGACGCCCAAGGCGCGCATCAACACCCTTCTAGGCTACACGGCACCCTTCGATCGC
CATGATTGGGTTATTGACCGTTGCGGTACCCGTGTCGACTACGTCATCGACTTTTACGCCGGCCGCTCTGATGGC
AAGCCCGGCCCCAGCTTCTACCTCGACGTCAGGCCGAAGCTGAACACGTGGGAAGGCGTCAAAATGCGCGCTCTG
AGATGGGCGTATCTGGCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail