Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3434
Gene name
Locationscaffold_272:8560..10106
Strand-
Gene length (bp)1546
Transcript length (bp)1461
Coding sequence length (bp)1458
Protein length (aa) 486

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02487 CLN3 CLN3 protein 6.8E-149 77 467

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4HX89|BTN1_GIBZE Protein BTN1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=BTN1 PE=3 SV=2 56 481 0.0E+00
sp|Q7SC45|BTN1_NEUCR Protein btn-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cln3 PE=3 SV=2 62 481 6.0E-178
sp|Q2GN49|BTN1_CHAGB Protein BTN1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=BTN1 PE=3 SV=1 62 481 1.0E-158
sp|Q4X0S3|BTN1_ASPFU Protein btn1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=btn1 PE=3 SV=1 63 480 4.0E-151
sp|Q6BZW3|BTN1_YARLI Protein BTN1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=BTN1 PE=3 SV=1 70 479 5.0E-116
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4HX89|BTN1_GIBZE Protein BTN1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=BTN1 PE=3 SV=2 56 481 0.0E+00
sp|Q7SC45|BTN1_NEUCR Protein btn-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cln3 PE=3 SV=2 62 481 6.0E-178
sp|Q2GN49|BTN1_CHAGB Protein BTN1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=BTN1 PE=3 SV=1 62 481 1.0E-158
sp|Q4X0S3|BTN1_ASPFU Protein btn1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=btn1 PE=3 SV=1 63 480 4.0E-151
sp|Q6BZW3|BTN1_YARLI Protein BTN1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=BTN1 PE=3 SV=1 70 479 5.0E-116
sp|Q6CLN9|BTN1_KLULA Protein BTN1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=BTN1 PE=3 SV=1 72 479 6.0E-106
sp|Q758C3|BTN1_ASHGO Protein BTN1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=BTN1 PE=3 SV=1 79 479 1.0E-104
sp|Q59LX9|BTN1_CANAL Protein BTN1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=BTN1 PE=3 SV=1 74 477 1.0E-101
sp|Q6BZ39|BTN1_DEBHA Protein BTN1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=BTN1 PE=3 SV=2 71 477 2.0E-99
sp|Q6FPB6|BTN1_CANGA Protein BTN1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=BTN1 PE=3 SV=1 70 479 2.0E-94
sp|P47040|BTN1_YEAST Protein BTN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHC3 PE=3 SV=1 74 479 2.0E-85
sp|Q9US09|BTN1_SCHPO Protein btn1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=btn1 PE=1 SV=1 64 479 7.0E-81
sp|Q29611|CLN3_CANLF Battenin OS=Canis lupus familiaris GN=CLN3 PE=3 SV=1 74 467 1.0E-61
sp|Q4P4U7|BTN1_USTMA Protein BTN1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=BTN1 PE=3 SV=2 58 479 5.0E-51
sp|Q13286|CLN3_HUMAN Battenin OS=Homo sapiens GN=CLN3 PE=1 SV=1 77 467 2.0E-49
sp|Q60HH0|CLN3_MACFA Battenin OS=Macaca fascicularis GN=CLN3 PE=2 SV=1 77 467 7.0E-46
sp|Q61124|CLN3_MOUSE Battenin OS=Mus musculus GN=Cln3 PE=1 SV=2 77 466 2.0E-40
sp|P0CM43|BTN1_CRYNB Protein BTN1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=BTN1 PE=3 SV=1 69 478 2.0E-39
sp|P0CM42|BTN1_CRYNJ Protein BTN1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=BTN1 PE=3 SV=1 69 478 2.0E-39
sp|Q54F25|CLN3_DICDI Battenin OS=Dictyostelium discoideum GN=cln3 PE=3 SV=1 74 462 1.0E-28
[Show less]

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 34 0.45

Transmembrane Domains

Domain # Start End Length
1 76 98 22
2 108 130 22
3 137 154 17
4 164 186 22
5 193 215 22
6 225 244 19
7 308 326 18
8 346 363 17
9 376 398 22
10 402 424 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3434
MAPPPLDFISSALYHHQHHLLLLLLNHHHHIRLRRLTAMASPGRLTAFSPALLGVSRSSRVARLVALLRKPEARV
LIAFWLLGLINNVLYVIVLSAAQDLVGSLPKGIVLLADVMPSFAVKLVGPYVMHAVPYRVRIPVFIALASTGMLL
VALTPPSRSVAVKMTGVVLASLSSGGGELSFLSLLHYYGENGLVGWGSGTGAAGLVGAGLYELLTAWLGFDVSQA
LLLSACLPVVMFISFFFILPQEPLLRSLGHRQDYEAVPAREAMDEPAVMTEALLAPSSSAVYAPGSNPKSRSLVA
NLKRARSLLVPYMIPLFLVYVAEYTINQGVSPTLLFPPEESPFSQLRGFYPFYGFLYQLGVFISRSSTSLLRVHS
LYLPSFLQLGNLVLLTLHSLFYFLPSVYVVFFIVFWEGLLGGCVYVNCFAEILERVPAEDREFSLGATAVSDSAG
ISAAGILSIAVETRLCEYQVAHGRKWCRMIQTPDTR
Coding >Ophio5|3434
ATGGCTCCCCCCCCCTTGGACTTCATCTCATCCGCTCTCTACCACCACCAACACCACCTCCTCCTCCTCCTCCTC
AACCACCACCACCATATTCGGCTCCGTCGACTCACGGCCATGGCCTCTCCCGGCCGCCTTACCGCTTTCTCTCCT
GCGCTGCTTGGCGTCTCGCGCTCGTCGAGGGTCGCGAGGCTCGTCGCGCTGCTACGCAAGCCCGAAGCCCGCGTC
CTCATCGCCTTCTGGCTTCTCGGTCTTATCAACAATGTCTTGTACGTCATCGTTCTCTCCGCCGCCCAGGACCTC
GTCGGCTCGCTCCCCAAGGGAATCGTCCTGTTGGCCGACGTCATGCCATCCTTTGCTGTCAAGCTCGTTGGCCCG
TACGTGATGCACGCCGTACCATACCGGGTTCGAATTCCCGTATTTATCGCTCTGGCCTCGACTGGCATGCTGCTT
GTTGCTCTTACGCCTCCGTCGCGCTCCGTCGCCGTCAAGATGACCGGCGTAGTCCTCGCTAGCTTGAGCAGCGGT
GGCGGTGAGCTCAGCTTCCTCTCTCTCCTCCACTATTATGGCGAAAACGGCCTTGTCGGTTGGGGCTCCGGGACT
GGCGCTGCCGGTCTTGTTGGCGCAGGCCTGTACGAGCTGTTGACGGCCTGGCTAGGCTTTGACGTCAGCCAGGCT
CTCCTTTTGTCTGCCTGCCTGCCCGTCGTCATGTTCATCAGCTTCTTTTTTATCCTGCCGCAGGAGCCTCTACTT
CGCTCTCTTGGCCATCGCCAAGACTACGAGGCTGTGCCGGCCCGGGAGGCCATGGACGAGCCGGCCGTCATGACG
GAAGCGCTGCTGGCCCCGTCGTCTTCAGCCGTCTACGCGCCCGGCTCGAATCCCAAGTCGAGATCGCTCGTGGCC
AATCTCAAGCGCGCAAGGTCGCTGCTTGTACCGTACATGATTCCTTTGTTTCTAGTCTACGTTGCCGAATACACC
ATCAACCAGGGTGTGTCGCCGACTCTGCTGTTTCCCCCAGAGGAGTCGCCTTTCAGCCAGCTTCGCGGCTTCTAC
CCCTTTTACGGCTTTCTCTACCAGCTTGGCGTCTTCATCTCTCGCTCGTCGACCTCGCTCCTTCGAGTGCACAGC
CTCTACCTGCCCTCATTCCTCCAGCTCGGCAATCTTGTTCTGCTGACGCTGCACTCGCTCTTCTACTTTCTGCCG
TCCGTCTACGTCGTCTTTTTCATCGTCTTCTGGGAAGGCCTCCTTGGCGGCTGCGTCTACGTCAACTGCTTTGCC
GAGATCCTTGAAAGGGTTCCGGCCGAGGACCGCGAGTTCAGCCTAGGGGCGACGGCCGTGAGCGACAGCGCCGGC
ATATCCGCTGCCGGCATCCTAAGCATCGCCGTGGAAACAAGATTGTGCGAATATCAGGTCGCCCATGGACGCAAG
TGGTGCCGCATGATTCAGACACCCGACACTCGA
Transcript >Ophio5|3434
ATGGCTCCCCCCCCCTTGGACTTCATCTCATCCGCTCTCTACCACCACCAACACCACCTCCTCCTCCTCCTCCTC
AACCACCACCACCATATTCGGCTCCGTCGACTCACGGCCATGGCCTCTCCCGGCCGCCTTACCGCTTTCTCTCCT
GCGCTGCTTGGCGTCTCGCGCTCGTCGAGGGTCGCGAGGCTCGTCGCGCTGCTACGCAAGCCCGAAGCCCGCGTC
CTCATCGCCTTCTGGCTTCTCGGTCTTATCAACAATGTCTTGTACGTCATCGTTCTCTCCGCCGCCCAGGACCTC
GTCGGCTCGCTCCCCAAGGGAATCGTCCTGTTGGCCGACGTCATGCCATCCTTTGCTGTCAAGCTCGTTGGCCCG
TACGTGATGCACGCCGTACCATACCGGGTTCGAATTCCCGTATTTATCGCTCTGGCCTCGACTGGCATGCTGCTT
GTTGCTCTTACGCCTCCGTCGCGCTCCGTCGCCGTCAAGATGACCGGCGTAGTCCTCGCTAGCTTGAGCAGCGGT
GGCGGTGAGCTCAGCTTCCTCTCTCTCCTCCACTATTATGGCGAAAACGGCCTTGTCGGTTGGGGCTCCGGGACT
GGCGCTGCCGGTCTTGTTGGCGCAGGCCTGTACGAGCTGTTGACGGCCTGGCTAGGCTTTGACGTCAGCCAGGCT
CTCCTTTTGTCTGCCTGCCTGCCCGTCGTCATGTTCATCAGCTTCTTTTTTATCCTGCCGCAGGAGCCTCTACTT
CGCTCTCTTGGCCATCGCCAAGACTACGAGGCTGTGCCGGCCCGGGAGGCCATGGACGAGCCGGCCGTCATGACG
GAAGCGCTGCTGGCCCCGTCGTCTTCAGCCGTCTACGCGCCCGGCTCGAATCCCAAGTCGAGATCGCTCGTGGCC
AATCTCAAGCGCGCAAGGTCGCTGCTTGTACCGTACATGATTCCTTTGTTTCTAGTCTACGTTGCCGAATACACC
ATCAACCAGGGTGTGTCGCCGACTCTGCTGTTTCCCCCAGAGGAGTCGCCTTTCAGCCAGCTTCGCGGCTTCTAC
CCCTTTTACGGCTTTCTCTACCAGCTTGGCGTCTTCATCTCTCGCTCGTCGACCTCGCTCCTTCGAGTGCACAGC
CTCTACCTGCCCTCATTCCTCCAGCTCGGCAATCTTGTTCTGCTGACGCTGCACTCGCTCTTCTACTTTCTGCCG
TCCGTCTACGTCGTCTTTTTCATCGTCTTCTGGGAAGGCCTCCTTGGCGGCTGCGTCTACGTCAACTGCTTTGCC
GAGATCCTTGAAAGGGTTCCGGCCGAGGACCGCGAGTTCAGCCTAGGGGCGACGGCCGTGAGCGACAGCGCCGGC
ATATCCGCTGCCGGCATCCTAAGCATCGCCGTGGAAACAAGATTGTGCGAATATCAGGTCGCCCATGGACGCAAG
TGGTGCCGCATGATTCAGACACCCGACACTCGATGA
Gene >Ophio5|3434
ATGGCTCCCCCCCCCTTGGACTTCATCTCATCCGCTCTCTACCACCACCAACACCACCTCCTCCTCCTCCTCCTC
AACCACCACCACCATATTCGGCTCCGTCGACTCACGGCCATGGCCTCTCCCGGCCGCCTTACCGCTTTCTCTCCT
GCGCTGCTTGGCGTCTCGCGCTCGTCGAGGGTCGCGAGGCTCGTCGCGCTGCTACGCAAGCCCGAAGCCCGCGTC
CTCATCGCCTTCTGGCTTCTCGGTGAGTAATAATAACCTTCCCCCTCTCCCCGCCTCCGTTGCCCGCCTACGCTA
AACGAGCCCTTTCTGACGATTATTCTCCCCAGGTCTTATCAACAATGTCTTGTACGTCATCGTTCTCTCCGCCGC
CCAGGACCTCGTCGGCTCGCTCCCCAAGGGAATCGTCCTGTTGGCCGACGTCATGCCATCCTTTGCTGTCAAGCT
CGTTGGCCCGTACGTGATGCACGCCGTACCATACCGGGTTCGAATTCCCGTATTTATCGCTCTGGCCTCGACTGG
CATGCTGCTTGTTGCTCTTACGCCTCCGTCGCGCTCCGTCGCCGTCAAGATGACCGGCGTAGTCCTCGCTAGCTT
GAGCAGCGGTGGCGGTGAGCTCAGCTTCCTCTCTCTCCTCCACTATTATGGCGAAAACGGCCTTGTCGGTTGGGG
CTCCGGGACTGGCGCTGCCGGTCTTGTTGGCGCAGGCCTGTACGAGCTGTTGACGGCCTGGCTAGGCTTTGACGT
CAGCCAGGCTCTCCTTTTGTCTGCCTGCCTGCCCGTCGTCATGTTCATCAGCTTCTTTTTTATCCTGCCGCAGGA
GCCTCTACTTCGCTCTCTTGGCCATCGCCAAGACTACGAGGCTGTGCCGGCCCGGGAGGCCATGGACGAGCCGGC
CGTCATGACGGAAGCGCTGCTGGCCCCGTCGTCTTCAGCCGTCTACGCGCCCGGCTCGAATCCCAAGTCGAGATC
GCTCGTGGCCAATCTCAAGCGCGCAAGGTCGCTGCTTGTACCGTACATGATTCCTTTGTTTCTAGTCTACGTTGC
CGAATACACCATCAACCAGGGTGTGTCGCCGACTCTGCTGTTTCCCCCAGAGGAGTCGCCTTTCAGCCAGCTTCG
CGGCTTCTACCCCTTTTACGGCTTTCTCTACCAGCTTGGCGTCTTCATCTCTCGCTCGTCGACCTCGCTCCTTCG
AGTGCACAGCCTCTACCTGCCCTCATTCCTCCAGCTCGGCAATCTTGTTCTGCTGACGCTGCACTCGCTCTTCTA
CTTTCTGCCGTCCGTCTACGTCGTCTTTTTCATCGTCTTCTGGGAAGGCCTCCTTGGCGGCTGCGTCTACGTCAA
CTGCTTTGCCGAGATCCTTGAAAGGGTTCCGGCCGAGGACCGCGAGTTCAGCCTAGGGGCGACGGCCGTGAGCGA
CAGCGCCGGCATATCCGCTGCCGGCATCCTAAGCATCGCCGTGGAAACAAGATTGTGCGAATATCAGGTCGCCCA
TGGACGCAAGTGGTGCCGCATGATTCAGACACCCGACACTCGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail