Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3433
Gene name
Locationscaffold_272:6758..8495
Strand+
Gene length (bp)1737
Transcript length (bp)1491
Coding sequence length (bp)1488
Protein length (aa) 496

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00172 Zn_clus Fungal Zn(2)-Cys(6) binuclear cluster domain 9.7E-05 112 143

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q59QC7|UPC2_CANAL Sterol uptake control protein 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=UPC2 PE=1 SV=1 87 142 2.0E-08
sp|Q05958|ECM22_YEAST Sterol regulatory element-binding protein ECM22 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ECM22 PE=1 SV=1 102 143 3.0E-08
sp|Q12151|UPC2_YEAST Sterol uptake control protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UPC2 PE=1 SV=1 84 143 3.0E-08
sp|Q9P326|PRO1_NEUCR Transcriptional regulatory protein pro1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=adv-1 PE=2 SV=1 101 142 3.0E-08

GO

GO Term Description Terminal node
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0008270 zinc ion binding Yes
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific Yes
GO:0008150 biological_process No
GO:0051252 regulation of RNA metabolic process No
GO:0060255 regulation of macromolecule metabolic process No
GO:0019222 regulation of metabolic process No
GO:0050794 regulation of cellular process No
GO:0140110 transcription regulator activity No
GO:0031323 regulation of cellular metabolic process No
GO:0065007 biological regulation No
GO:0046872 metal ion binding No
GO:0010468 regulation of gene expression No
GO:0043167 ion binding No
GO:0043169 cation binding No
GO:0003674 molecular_function No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0005488 binding No
GO:0080090 regulation of primary metabolic process No
GO:0009889 regulation of biosynthetic process No
GO:0050789 regulation of biological process No
GO:0003700 DNA-binding transcription factor activity No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:2001141 regulation of RNA biosynthetic process No
GO:0046914 transition metal ion binding No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0031326 regulation of cellular biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Fungal Specific TF

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3433
MIIQRLSTLPSAVDGPPASVFTSCPPSCPPSSSSLPSIPSSSSFSPLPLPLPLLPFLACLTPASLMPPSQMADNP
RSAPEPDFRVLSFPPRDGTASARRYQKRKPHKKSRAGCGPCKLRRVKCDQGRPCCERCLRLGSCCAYASDDRLAD
NSGRTDAVIVSRPFPALTLDAFASPHPSRSNNGTPRARLLHHLYNFFAWPLPFKCELQFLLTLGASQPFLLDVVL
AVAASHLRHHSVCKQPSRVAEQFQQSQAFRSFRLALDGPLNPQTADALVLTAHFFNVLSFSAVEDDNPAGSWIFS
RQPDRLAWLSVQFGFRPLVASTVAFRNQSKLNGVLYAPEDEEYAFLRDRTVPSSTVPDHWRSLLGLDGRDPDGQV
FHDPARVAAYLRRVEPIPDAFCHYCKFLSTIDIKLRFRDLLQREDERAVWLLGYWLGLLNRFQFWWMRLRVRMEW
QGICIWLDRRGVRSRGDVWKKLMRDLESVAEWPEPVSEMEEAADVV
Coding >Ophio5|3433
ATGATTATACAACGCCTTTCCACGCTGCCAAGCGCCGTAGATGGACCCCCGGCCTCAGTCTTCACCTCTTGTCCT
CCCTCTTGTCCTCCCTCTTCCTCGTCTCTTCCTTCAATCCCGTCCTCCTCGTCTTTCTCTCCTCTTCCTCTGCCT
CTTCCTCTTCTTCCTTTCCTCGCCTGCCTCACGCCCGCCTCGCTCATGCCACCTTCCCAAATGGCCGACAACCCC
CGCTCGGCCCCCGAGCCCGACTTTCGTGTCTTGAGCTTCCCCCCGCGAGACGGCACCGCCTCAGCGCGCCGTTAC
CAGAAGCGAAAGCCGCACAAAAAGTCCCGCGCTGGTTGTGGCCCTTGCAAGCTGAGGCGCGTCAAGTGCGATCAA
GGCCGGCCCTGCTGTGAGCGGTGCTTGCGCCTCGGTTCCTGCTGCGCGTACGCCTCCGACGACCGCTTGGCCGAT
AACAGTGGCCGAACCGATGCCGTCATCGTGTCCCGGCCCTTTCCGGCCTTGACCTTGGATGCCTTCGCCTCCCCT
CACCCGTCGCGTTCGAACAACGGCACGCCTCGCGCTCGTCTGCTTCATCACTTGTACAACTTCTTCGCCTGGCCG
CTGCCGTTCAAGTGTGAGCTCCAATTTCTCCTGACTCTGGGAGCGTCGCAGCCCTTCCTCCTTGACGTCGTCCTG
GCCGTAGCCGCCTCTCACCTGCGCCACCATTCCGTTTGCAAGCAGCCCAGCCGCGTGGCCGAGCAATTCCAACAA
TCCCAGGCCTTCCGCAGCTTCCGTCTCGCGCTCGACGGACCCCTGAATCCGCAGACGGCCGACGCCCTCGTTTTG
ACGGCCCACTTCTTCAACGTTCTCAGCTTCTCCGCCGTGGAAGACGACAACCCGGCCGGTTCATGGATCTTCAGC
CGCCAGCCGGACCGGCTGGCTTGGCTATCGGTTCAGTTTGGCTTCAGGCCTCTGGTTGCGTCCACCGTGGCCTTC
CGAAATCAAAGTAAGCTGAATGGCGTCCTTTACGCGCCCGAAGACGAGGAATATGCATTCCTTCGCGACAGAACC
GTGCCTTCATCCACGGTCCCTGACCACTGGAGGAGCTTGCTCGGGCTCGACGGCCGCGACCCCGACGGCCAAGTC
TTTCACGACCCGGCCAGAGTGGCCGCCTACCTCAGGCGTGTGGAGCCAATCCCGGATGCCTTTTGCCACTATTGC
AAGTTTTTATCCACCATTGACATCAAGCTTCGCTTTCGAGATCTGCTGCAGCGAGAGGATGAGCGAGCCGTCTGG
CTGCTCGGGTACTGGCTCGGTCTGTTGAACCGCTTCCAGTTTTGGTGGATGCGGCTGCGCGTCCGGATGGAATGG
CAGGGCATCTGCATCTGGCTGGATCGACGAGGGGTGCGCAGCAGAGGCGACGTTTGGAAGAAGCTTATGCGGGAC
CTGGAGTCGGTAGCCGAGTGGCCAGAGCCCGTGAGTGAGATGGAAGAGGCGGCCGATGTCGTA
Transcript >Ophio5|3433
ATGATTATACAACGCCTTTCCACGCTGCCAAGCGCCGTAGATGGACCCCCGGCCTCAGTCTTCACCTCTTGTCCT
CCCTCTTGTCCTCCCTCTTCCTCGTCTCTTCCTTCAATCCCGTCCTCCTCGTCTTTCTCTCCTCTTCCTCTGCCT
CTTCCTCTTCTTCCTTTCCTCGCCTGCCTCACGCCCGCCTCGCTCATGCCACCTTCCCAAATGGCCGACAACCCC
CGCTCGGCCCCCGAGCCCGACTTTCGTGTCTTGAGCTTCCCCCCGCGAGACGGCACCGCCTCAGCGCGCCGTTAC
CAGAAGCGAAAGCCGCACAAAAAGTCCCGCGCTGGTTGTGGCCCTTGCAAGCTGAGGCGCGTCAAGTGCGATCAA
GGCCGGCCCTGCTGTGAGCGGTGCTTGCGCCTCGGTTCCTGCTGCGCGTACGCCTCCGACGACCGCTTGGCCGAT
AACAGTGGCCGAACCGATGCCGTCATCGTGTCCCGGCCCTTTCCGGCCTTGACCTTGGATGCCTTCGCCTCCCCT
CACCCGTCGCGTTCGAACAACGGCACGCCTCGCGCTCGTCTGCTTCATCACTTGTACAACTTCTTCGCCTGGCCG
CTGCCGTTCAAGTGTGAGCTCCAATTTCTCCTGACTCTGGGAGCGTCGCAGCCCTTCCTCCTTGACGTCGTCCTG
GCCGTAGCCGCCTCTCACCTGCGCCACCATTCCGTTTGCAAGCAGCCCAGCCGCGTGGCCGAGCAATTCCAACAA
TCCCAGGCCTTCCGCAGCTTCCGTCTCGCGCTCGACGGACCCCTGAATCCGCAGACGGCCGACGCCCTCGTTTTG
ACGGCCCACTTCTTCAACGTTCTCAGCTTCTCCGCCGTGGAAGACGACAACCCGGCCGGTTCATGGATCTTCAGC
CGCCAGCCGGACCGGCTGGCTTGGCTATCGGTTCAGTTTGGCTTCAGGCCTCTGGTTGCGTCCACCGTGGCCTTC
CGAAATCAAAGTAAGCTGAATGGCGTCCTTTACGCGCCCGAAGACGAGGAATATGCATTCCTTCGCGACAGAACC
GTGCCTTCATCCACGGTCCCTGACCACTGGAGGAGCTTGCTCGGGCTCGACGGCCGCGACCCCGACGGCCAAGTC
TTTCACGACCCGGCCAGAGTGGCCGCCTACCTCAGGCGTGTGGAGCCAATCCCGGATGCCTTTTGCCACTATTGC
AAGTTTTTATCCACCATTGACATCAAGCTTCGCTTTCGAGATCTGCTGCAGCGAGAGGATGAGCGAGCCGTCTGG
CTGCTCGGGTACTGGCTCGGTCTGTTGAACCGCTTCCAGTTTTGGTGGATGCGGCTGCGCGTCCGGATGGAATGG
CAGGGCATCTGCATCTGGCTGGATCGACGAGGGGTGCGCAGCAGAGGCGACGTTTGGAAGAAGCTTATGCGGGAC
CTGGAGTCGGTAGCCGAGTGGCCAGAGCCCGTGAGTGAGATGGAAGAGGCGGCCGATGTCGTATAG
Gene >Ophio5|3433
ATGAGTAAGTAGTAGTAGCCAATACATGTTGAGCACTTCACAGGCCATATCACACCTATCTCGGCCTGTCTCCCT
CATCCTTGGCACGGCCCCCTTCACCACACCCTCAATGGTCGTGACACCCCTCGCTTACCATGTCTTGTCATAGTT
ATACAACGCCTTTCCACGCTGCCAAGCGCCGTAGATGGACGTCAGGGGCTGACCTCAGCCAACGCCGCTTACATG
CCGTGTCAGCCCCGGCCTCAGTCTTCACCTCTTGTCCTCCCTCTTGTCCTCCCTCTTCCTCGTCTCTTCCTTCAA
TCCCGTCCTCCTCGTCTTTCTCTCCTCTTCCTCTGCCTCTTCCTCTTCTTCCTTTCCTCGCCTGCCTCACGCCCG
CCTCGCTCATGCCACCTTCCCAAATGGCCGACAACCCCCGCTCGGCCCCCGAGCCCGACTTTCGTGTCTTGAGCT
TCCCCCCGCGAGACGGCACCGCCTCAGCGCGCCGTTACCAGAAGCGAAAGCCGCACAAAAAGTCCCGCGCTGGTT
GTGGCCCTTGCAAGCTGAGGCGCGTCAAGGTCTTTCTGCTCTCGTCCCTCCCTCGCGCTGTCCGTCCACGGCTGA
TCCTGGCATCAGTGCGATCAAGGCCGGCCCTGCTGTGAGCGGTGCTTGCGCCTCGGTTCCTGCTGCGCGTACGCC
TCCGACGACCGCTTGGCCGATAACAGTGGCCGAACCGATGCCGTCATCGTGTCCCGGCCCTTTCCGGCCTTGACC
TTGGATGCCTTCGCCTCCCCTCACCCGTCGCGTTCGAACAACGGCACGCCTCGCGCTCGTCTGCTTCATCACTTG
TACAACTTCTTCGCCTGGCCGCTGCCGTTCAAGTGTGAGCTCCAATTTCTCCTGACTCTGGGAGCGTCGCAGCCC
TTCCTCCTTGACGTCGTCCTGGCCGTAGCCGCCTCTCACCTGCGCCACCATTCCGTTTGCAAGCAGCCCAGCCGC
GTGGCCGAGCAATTCCAACAATCCCAGGCCTTCCGCAGCTTCCGTCTCGCGCTCGACGGACCCCTGAATCCGCAG
ACGGCCGACGCCCTCGTTTTGACGGCCCACTTCTTCAACGTTCTCAGCTTCTCCGCCGTGGAAGACGACAACCCG
GCCGGTTCATGGATCTTCAGCCGCCAGCCGGACCGGCTGGCTTGGCTATCGGTTCAGTTTGGCTTCAGGCCTCTG
GTTGCGTCCACCGTGGCCTTCCGAAATCAAAGTAAGCTGAATGGCGTCCTTTACGCGCCCGAAGACGAGGAATAT
GCATTCCTTCGCGACAGAACCGTGCCTTCATCCACGGTCCCTGACCACTGGAGGAGCTTGCTCGGGCTCGACGGC
CGCGACCCCGACGGCCAAGTCTTTCACGACCCGGCCAGAGTGGCCGCCTACCTCAGGCGTGTGGAGCCAATCCCG
GATGCCTTTTGCCACTATTGCAAGTTTTTATCCACCATTGACATCAAGCTTCGCTTTCGAGATCTGCTGCAGCGA
GAGGATGAGCGAGCCGTCTGGCTGCTCGGGTACTGGCTCGGTCTGTTGAACCGCTTCCAGTTTTGGTGGATGCGG
CTGCGCGTCCGGATGGAATGGCAGGGCATCTGCATCTGGCTGGATCGACGAGGGGTGCGCAGCAGAGGCGACGTT
TGGAAGAAGCTTATGCGGGACCTGGAGTCGGTAGCCGAGTGGCCAGAGCCCGTGAGTGAGATGGAAGAGGCGGCC
GATGTCGTATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail