Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3420
Gene name
Locationscaffold_271:3659..4215
Strand-
Gene length (bp)556
Transcript length (bp)504
Coding sequence length (bp)501
Protein length (aa) 167

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08589 ATG43 Autophagy receptor ATG43 1.5E-35 14 111

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0140580 mitochondrion autophagosome adaptor activity Yes
GO:0000423 mitophagy Yes
GO:0008150 biological_process No
GO:0006996 organelle organization No
GO:0007005 mitochondrion organization No
GO:0061919 process utilizing autophagic mechanism No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0043495 protein-membrane adaptor activity No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0061912 selective autophagy No
GO:0022411 cellular component disassembly No
GO:0000422 autophagy of mitochondrion No
GO:0009056 catabolic process No
GO:0016043 cellular component organization No
GO:0006914 autophagy No
GO:0044248 cellular catabolic process No
GO:0016236 macroautophagy No
GO:0061726 mitochondrion disassembly No
GO:0030674 protein-macromolecule adaptor activity No
GO:1903008 organelle disassembly No
GO:0060090 molecular adaptor activity No
GO:0071840 cellular component organization or biogenesis No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3420
MSSLHGELIVGELAATVQAGHIRADPDPRLDIAPSTAAEKKQVLSVESRDRACKTNDDIDGNDEEDDIPCSVLRP
TPRRRNLPPLPDLRFEQSYLHSISNADTWWKVMLITVRDQMVMPLAQGLIYNLLLNGWQYSRRNARFHGTSSGAR
LRRWWYGVNNWSIPSSK
Coding >Ophio5|3420
ATGTCCTCCCTCCACGGCGAACTGATCGTCGGCGAGCTGGCCGCTACCGTTCAGGCCGGTCACATTCGCGCAGAC
CCGGATCCACGACTTGACATCGCTCCGTCTACCGCCGCCGAGAAGAAGCAGGTCCTCTCGGTAGAGAGCCGCGAC
CGCGCTTGCAAGACCAACGACGACATCGACGGTAACGACGAAGAAGACGACATCCCCTGCAGTGTCCTCCGGCCG
ACCCCGCGGAGGCGCAACTTGCCACCCTTGCCAGACCTGCGCTTCGAGCAGAGCTACCTCCATAGCATATCCAAC
GCCGACACGTGGTGGAAGGTGATGCTCATCACTGTTCGCGACCAGATGGTCATGCCCCTGGCTCAGGGCCTGATT
TACAACCTCCTCTTGAATGGATGGCAGTATTCGAGACGAAACGCAAGATTCCATGGAACCTCGTCAGGAGCCAGA
CTCAGGAGGTGGTGGTACGGCGTGAACAATTGGTCCATACCCAGCAGCAAG
Transcript >Ophio5|3420
ATGTCCTCCCTCCACGGCGAACTGATCGTCGGCGAGCTGGCCGCTACCGTTCAGGCCGGTCACATTCGCGCAGAC
CCGGATCCACGACTTGACATCGCTCCGTCTACCGCCGCCGAGAAGAAGCAGGTCCTCTCGGTAGAGAGCCGCGAC
CGCGCTTGCAAGACCAACGACGACATCGACGGTAACGACGAAGAAGACGACATCCCCTGCAGTGTCCTCCGGCCG
ACCCCGCGGAGGCGCAACTTGCCACCCTTGCCAGACCTGCGCTTCGAGCAGAGCTACCTCCATAGCATATCCAAC
GCCGACACGTGGTGGAAGGTGATGCTCATCACTGTTCGCGACCAGATGGTCATGCCCCTGGCTCAGGGCCTGATT
TACAACCTCCTCTTGAATGGATGGCAGTATTCGAGACGAAACGCAAGATTCCATGGAACCTCGTCAGGAGCCAGA
CTCAGGAGGTGGTGGTACGGCGTGAACAATTGGTCCATACCCAGCAGCAAGTAA
Gene >Ophio5|3420
ATGTCCTCCCTCCACGGCGAACTGATCGTCGGCGAGCTGGCCGCTACCGTTCAGGCCGGTCACATTCGCGCAGAC
CCGGATCCACGACTTGACATCGCTCCGTCTACCGCCGCCGAGAAGAAGCAGGTCCTCTCGGTAGAGAGCCGCGAC
CGCGCTTGCAAGACCAACGACGACATCGACGGTAACGACGAAGAAGACGACATCCCCTGCAGTGTCCTCCGGCCG
ACCCCGCGGAGGCGCAACTTGCCACCCTTGCCAGACCTGCGCTTCGAGCAGAGCTACCTCCATAGCATATCCAAC
GCCGACACGTGGTGGAAGGTGATGCTCATCACTGTTCGCGACCAGGTATGCTTTCATCACAGGGACAGCTACCTA
GCTGAACTCTCACGCCCCGCAGATGGTCATGCCCCTGGCTCAGGGCCTGATTTACAACCTCCTCTTGAATGGATG
GCAGTATTCGAGACGAAACGCAAGATTCCATGGAACCTCGTCAGGAGCCAGACTCAGGAGGTGGTGGTACGGCGT
GAACAATTGGTCCATACCCAGCAGCAAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail