Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3418
Gene name
Locationscaffold_270:2220..25680
Strand+
Gene length (bp)23460
Transcript length (bp)23178
Coding sequence length (bp)23175
Protein length (aa) 7725

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00501 AMP-binding AMP-binding enzyme 3.3E-69 31 416
PF00501 AMP-binding AMP-binding enzyme 4.3E-20 1080 1185
PF00501 AMP-binding AMP-binding enzyme 1.9E-30 1223 1438
PF00501 AMP-binding AMP-binding enzyme 1.4E-68 2581 2971
PF00501 AMP-binding AMP-binding enzyme 6.2E-75 4102 4495
PF00501 AMP-binding AMP-binding enzyme 1.4E-67 5637 6026
PF00501 AMP-binding AMP-binding enzyme 2.2E-41 6705 7073
PF00668 Condensation Condensation domain 1.7E-29 656 1054
PF00668 Condensation Condensation domain 5.8E-34 1673 2089
PF00668 Condensation Condensation domain 3.9E-43 2133 2554
PF00668 Condensation Condensation domain 3.0E-30 3192 3605
PF00668 Condensation Condensation domain 1.8E-54 3649 4080
PF00668 Condensation Condensation domain 3.9E-28 4719 5142
PF00668 Condensation Condensation domain 3.1E-51 5182 5610
PF00668 Condensation Condensation domain 1.2E-22 6266 6674
PF00668 Condensation Condensation domain 1.5E-31 7343 7723
PF00550 PP-binding Phosphopantetheine attachment site 6.3E-10 555 617
PF00550 PP-binding Phosphopantetheine attachment site 4.5E-10 1592 1653
PF00550 PP-binding Phosphopantetheine attachment site 1.6E-11 3111 3172
PF00550 PP-binding Phosphopantetheine attachment site 6.3E-12 4634 4697
PF00550 PP-binding Phosphopantetheine attachment site 8.7E-12 6162 6224
PF00550 PP-binding Phosphopantetheine attachment site 1.7E-09 7214 7276

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 29 3196 0.0E+00
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 3643 6642 0.0E+00
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 2091 4772 0.0E+00
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 5560 7389 0.0E+00
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 19 3355 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 29 3196 0.0E+00
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 3643 6642 0.0E+00
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 2091 4772 0.0E+00
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 5560 7389 0.0E+00
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 19 3355 0.0E+00
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 3647 6556 0.0E+00
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 4627 7689 0.0E+00
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2129 4867 0.0E+00
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 8 2416 0.0E+00
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 5180 7384 0.0E+00
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 3098 4867 0.0E+00
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 1560 3334 0.0E+00
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2120 4002 0.0E+00
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 3607 5543 0.0E+00
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 29 1809 0.0E+00
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 3645 4842 0.0E+00
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2112 3181 0.0E+00
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 4032 7629 0.0E+00
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 2499 4687 0.0E+00
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 1053 3198 0.0E+00
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 5175 7653 0.0E+00
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 24 1837 0.0E+00
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 25 1676 0.0E+00
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 25 2592 0.0E+00
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 3882 6139 0.0E+00
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 2340 4609 0.0E+00
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 3600 5604 0.0E+00
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 857 3088 0.0E+00
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 2090 4072 0.0E+00
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 5366 7475 0.0E+00
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 2494 7570 0.0E+00
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 997 4904 0.0E+00
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 642 3333 0.0E+00
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 3863 6223 0.0E+00
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 5623 7723 0.0E+00
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 25 1744 0.0E+00
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 5623 7707 0.0E+00
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 12 1734 0.0E+00
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 5623 7707 0.0E+00
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 12 1734 0.0E+00
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 3653 7272 0.0E+00
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 14 3333 0.0E+00
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 3695 7281 0.0E+00
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 14 3365 0.0E+00
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2239 5150 0.0E+00
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2242 4898 0.0E+00
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 3653 7278 0.0E+00
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 14 3333 0.0E+00
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 2166 4866 0.0E+00
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 3780 7529 0.0E+00
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 29 3355 0.0E+00
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 2 3246 0.0E+00
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 2132 4910 0.0E+00
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 3542 6294 0.0E+00
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 2094 4696 0.0E+00
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 41 3333 0.0E+00
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 3701 6223 0.0E+00
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 2125 4871 0.0E+00
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 20 3171 0.0E+00
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 3693 6223 0.0E+00
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 2239 4697 0.0E+00
sp|Q4WMK2|NRPS9_ASPFU Nonribosomal peptide syntethase 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS9 PE=3 SV=1 3995 5140 0.0E+00
sp|Q4WMK2|NRPS9_ASPFU Nonribosomal peptide syntethase 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS9 PE=3 SV=1 2515 3601 0.0E+00
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 5569 6679 0.0E+00
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 983 3194 0.0E+00
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 3929 6237 0.0E+00
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 2536 4707 2.0E-178
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 5615 7459 3.0E-177
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 6258 7723 2.0E-175
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 24 1066 5.0E-169
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 14 1998 1.0E-166
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 5181 7589 2.0E-165
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 5177 7604 2.0E-161
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 5179 7278 3.0E-160
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 5180 7621 4.0E-159
sp|Q4WMK2|NRPS9_ASPFU Nonribosomal peptide syntethase 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS9 PE=3 SV=1 1015 2089 3.0E-158
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 5163 6337 6.0E-155
sp|Q4WLW8|NRP11_ASPFU Nonribosomal peptide synthetase 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS11 PE=2 SV=1 5601 6576 2.0E-152
sp|Q4WYP0|NRPS6_ASPFU Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 5594 6582 6.0E-152
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 5174 6556 4.0E-151
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 14 2067 4.0E-151
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 5183 7719 2.0E-150
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 29 2067 7.0E-150
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 5180 7719 9.0E-149
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 5180 7719 1.0E-148
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 29 2067 6.0E-148
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 3833 4901 8.0E-147
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 5628 7629 1.0E-146
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 5174 6556 2.0E-146
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 3645 4697 5.0E-146
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 3645 4697 1.0E-145
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 5174 6551 2.0E-145
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 5177 7570 3.0E-145
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 30 2103 2.0E-144
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 3039 4706 2.0E-143
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 29 2066 2.0E-143
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 5177 7373 3.0E-143
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 5152 7463 5.0E-143
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 5183 7285 6.0E-143
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 5573 7614 1.0E-142
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 5178 7272 2.0E-142
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 16 2071 3.0E-141
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 3643 4697 2.0E-140
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 5181 7494 6.0E-140
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 5183 7621 1.0E-139
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 29 2068 2.0E-139
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 29 2114 3.0E-139
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 29 2118 3.0E-139
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 5177 7132 5.0E-139
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 2127 3171 7.0E-138
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 4570 6223 8.0E-138
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 5184 7285 2.0E-137
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 30 1761 6.0E-137
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 1501 3179 6.0E-137
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 2131 3184 2.0E-136
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 2131 3184 2.0E-136
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 5186 7529 2.0E-136
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 5182 7719 2.0E-135
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 5181 7495 3.0E-134
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 4049 4875 4.0E-134
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 29 2103 5.0E-134
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 29 1774 8.0E-134
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 25 953 1.0E-133
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 5177 6412 2.0E-133
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 5180 7621 6.0E-132
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 5183 7570 5.0E-130
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 5183 7570 7.0E-130
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 5186 7274 1.0E-129
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 3643 5186 3.0E-129
sp|Q4WYP0|NRPS6_ASPFU Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 6465 7719 5.0E-128
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 16 1829 1.0E-127
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 14 1698 3.0E-127
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 14 1847 5.0E-127
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 29 1631 3.0E-126
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 5184 7379 3.0E-126
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 5186 7463 7.0E-126
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 14 2042 7.0E-126
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 3647 4952 1.0E-125
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 1 1448 2.0E-125
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 14 1894 3.0E-125
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 5163 7497 4.0E-125
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 5650 7627 7.0E-124
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 5168 7494 2.0E-123
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 3697 5138 4.0E-123
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 5307 7723 4.0E-123
sp|Q4WYP0|NRPS6_ASPFU Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 3888 4697 6.0E-123
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 5164 7627 6.0E-123
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 29 1985 7.0E-123
sp|Q4WYP0|NRPS6_ASPFU Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 25 951 3.0E-122
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 25 784 1.0E-121
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 14 1835 1.0E-121
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 22 971 2.0E-121
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 655 1861 2.0E-121
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 5377 6329 3.0E-121
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 2313 3358 8.0E-121
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 655 1853 1.0E-120
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2179 3540 2.0E-120
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 3663 5168 2.0E-120
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 5227 7614 1.0E-119
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 15 1850 1.0E-119
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 650 1664 6.0E-119
sp|Q4WYP0|NRPS6_ASPFU Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 2367 3171 8.0E-119
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 14 1690 1.0E-118
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 2098 3604 1.0E-118
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 2169 3630 2.0E-118
sp|Q4WLW8|NRP11_ASPFU Nonribosomal peptide synthetase 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS11 PE=2 SV=1 25 976 6.0E-118
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 2134 3620 7.0E-118
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 14 1835 1.0E-117
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 25 998 2.0E-117
sp|Q4WMK2|NRPS9_ASPFU Nonribosomal peptide syntethase 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS9 PE=3 SV=1 5578 6213 2.0E-117
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 3643 5145 2.0E-117
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 2135 3590 5.0E-117
sp|Q4WLW8|NRP11_ASPFU Nonribosomal peptide synthetase 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS11 PE=2 SV=1 6686 7663 2.0E-116
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 3617 5135 4.0E-116
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 25 1829 1.0E-115
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 2257 3633 1.0E-115
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 29 1829 4.0E-115
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 2183 3581 8.0E-115
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 14 1822 2.0E-114
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 3639 5141 8.0E-114
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 4094 4722 3.0E-113
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 14 1690 3.0E-113
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 6246 7463 4.0E-113
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 3621 4774 5.0E-113
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 5305 7471 5.0E-113
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 3639 5114 2.0E-112
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 654 1675 5.0E-112
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 4094 4719 6.0E-112
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 1046 1824 6.0E-112
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 4094 4719 8.0E-112
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 2129 3333 2.0E-111
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 16 2013 2.0E-111
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 3642 4895 4.0E-111
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 4 836 1.0E-110
sp|Q4WMK2|NRPS9_ASPFU Nonribosomal peptide syntethase 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS9 PE=3 SV=1 25 636 1.0E-110
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 5622 7282 2.0E-110
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 14 1830 2.0E-110
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 2064 3601 1.0E-109
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 2564 3172 2.0E-109
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 14 1821 5.0E-109
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 6239 7626 9.0E-109
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 3643 5115 1.0E-108
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 2510 3349 5.0E-108
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 2112 3176 1.0E-107
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 5576 7564 2.0E-107
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 3625 5138 3.0E-107
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 6426 7627 4.0E-107
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 2573 3196 4.0E-107
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 6639 7627 6.0E-107
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 5543 7270 7.0E-107
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 5311 7286 9.0E-107
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 4032 4772 2.0E-106
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 2581 3166 2.0E-106
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 2581 3166 2.0E-106
sp|Q4WLW8|NRP11_ASPFU Nonribosomal peptide synthetase 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS11 PE=2 SV=1 4094 4719 4.0E-106
sp|P0C062|GRSA_BREBE Gramicidin S synthase 1 OS=Brevibacillus brevis GN=grsA PE=3 SV=1 4091 5117 4.0E-106
sp|P0C061|GRSA_ANEMI Gramicidin S synthase 1 OS=Aneurinibacillus migulanus GN=grsA PE=1 SV=1 4091 5117 2.0E-105
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 3630 4782 5.0E-105
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 14 1835 1.0E-104
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 14 1835 1.0E-104
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 3647 4948 2.0E-104
sp|Q4WYP0|NRPS6_ASPFU Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 868 1655 5.0E-104
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 50 1653 6.0E-104
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 755 1741 2.0E-103
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 3647 4893 2.0E-103
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 2088 3632 2.0E-103
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 3647 4948 3.0E-103
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 2113 3262 3.0E-103
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 6623 7627 4.0E-103
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 2120 3333 2.0E-102
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 32 1839 9.0E-102
sp|Q4WLW8|NRP11_ASPFU Nonribosomal peptide synthetase 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS11 PE=2 SV=1 2546 3179 1.0E-101
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 5377 7570 1.0E-101
sp|P09095|TYCA_BREPA Tyrocidine synthase 1 OS=Brevibacillus parabrevis GN=tycA PE=1 SV=2 2560 3634 1.0E-101
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 1074 1839 2.0E-101
sp|P09095|TYCA_BREPA Tyrocidine synthase 1 OS=Brevibacillus parabrevis GN=tycA PE=1 SV=2 4096 5135 2.0E-101
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 5168 6654 3.0E-101
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 2135 3583 5.0E-101
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 5546 7718 5.0E-101
sp|Q4WLW8|NRP11_ASPFU Nonribosomal peptide synthetase 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS11 PE=2 SV=1 1071 1663 1.0E-100
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 5167 6528 1.0E-100
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 5546 7718 1.0E-100
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 45 1729 2.0E-100
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 29 1657 4.0E-100
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 2127 3333 2.0E-99
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 3646 4869 2.0E-99
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 29 962 9.0E-99
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 2127 3505 1.0E-98
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 653 1869 6.0E-98
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 3644 4888 8.0E-98
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 5312 7401 8.0E-98
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 27 943 1.0E-97
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 5312 7401 1.0E-97
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 3642 4714 2.0E-97
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 27 727 3.0E-97
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 3784 5169 4.0E-97
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 3644 4875 6.0E-97
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 29 1994 8.0E-97
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 3642 4893 1.0E-96
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 3628 4775 1.0E-96
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 29 1994 1.0E-96
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 2246 3360 2.0E-96
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 2132 3368 2.0E-96
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 2129 3350 3.0E-96
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 1035 1824 4.0E-96
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 2129 3350 6.0E-96
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 1074 1839 9.0E-96
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 4091 4888 1.0E-95
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 5312 7270 1.0E-95
sp|P0C062|GRSA_BREBE Gramicidin S synthase 1 OS=Brevibacillus brevis GN=grsA PE=3 SV=1 2568 3582 1.0E-95
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 1074 1839 2.0E-95
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 2129 3358 2.0E-95
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 2131 3432 2.0E-95
sp|P0C061|GRSA_ANEMI Gramicidin S synthase 1 OS=Aneurinibacillus migulanus GN=grsA PE=1 SV=1 2568 3582 2.0E-95
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 3639 5164 4.0E-95
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 5614 7693 5.0E-95
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 5308 7463 6.0E-95
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 3647 4892 9.0E-95
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 2122 3383 8.0E-94
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 2112 3332 1.0E-93
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 3647 4893 3.0E-93
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 3643 4872 8.0E-93
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 2130 3362 3.0E-92
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 3643 4875 3.0E-92
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 6264 7724 4.0E-92
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 2127 3368 7.0E-92
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 50 1868 1.0E-91
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 6262 7622 2.0E-91
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 3777 4897 2.0E-91
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 3643 4878 3.0E-91
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 2127 3350 4.0E-91
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 6264 7723 5.0E-91
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2127 3333 2.0E-90
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 2135 3368 5.0E-90
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 5163 6513 6.0E-90
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 3648 4698 2.0E-89
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 3782 4700 3.0E-89
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 2135 3333 1.0E-88
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 2125 3172 2.0E-88
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 2121 3174 3.0E-88
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 2126 3364 5.0E-88
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 3689 4893 5.0E-88
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 5181 6557 5.0E-88
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 2239 3350 7.0E-88
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 3643 4893 8.0E-88
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 3572 4894 9.0E-88
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 2088 3359 5.0E-87
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 2206 3432 6.0E-87
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 5175 6224 6.0E-87
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 2088 3359 8.0E-87
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 653 1835 9.0E-87
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 2222 3428 2.0E-86
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 3775 5036 2.0E-86
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 2183 3532 6.0E-86
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 5161 6582 7.0E-86
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 3780 4875 9.0E-86
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 14 1184 1.0E-85
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 3644 4696 1.0E-85
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 5210 6405 9.0E-85
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 650 1855 9.0E-85
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 3821 4895 9.0E-85
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 655 1829 1.0E-84
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 47 1675 2.0E-84
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 3646 4924 2.0E-84
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 2258 3383 3.0E-84
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 5178 6223 3.0E-84
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 654 1835 1.0E-83
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 3642 4875 1.0E-83
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 3692 4865 3.0E-83
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 2241 3432 4.0E-83
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 2245 3218 6.0E-83
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 655 1829 6.0E-83
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 3693 4696 1.0E-82
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 3648 4954 1.0E-82
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 5164 6223 2.0E-82
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 2169 3332 2.0E-82
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 5210 6225 4.0E-82
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 2135 3335 4.0E-82
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 5151 6559 6.0E-82
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 3871 4897 6.0E-82
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 3694 4871 6.0E-82
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 2169 3500 9.0E-82
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 3642 4948 2.0E-81
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 2135 3428 2.0E-81
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 3871 4897 2.0E-81
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 30 970 3.0E-81
sp|P09095|TYCA_BREPA Tyrocidine synthase 1 OS=Brevibacillus parabrevis GN=tycA PE=1 SV=2 1076 2114 5.0E-81
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 2132 3370 7.0E-81
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 38 1201 7.0E-81
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 32 1184 1.0E-80
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 3780 4948 2.0E-80
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 654 1837 3.0E-80
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 3642 4700 3.0E-80
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 2140 3333 3.0E-80
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 3874 5029 3.0E-80
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 2108 3569 3.0E-80
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 3642 4700 5.0E-80
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 5186 6551 6.0E-80
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 33 808 7.0E-80
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 2169 3171 7.0E-80
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 32 1184 9.0E-80
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 5146 6230 1.0E-79
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 3642 4875 1.0E-79
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 3778 4866 4.0E-79
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 5175 6222 7.0E-79
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 2127 3179 7.0E-79
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 6263 7725 8.0E-79
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 654 1657 8.0E-79
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 5183 6222 1.0E-78
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 14 1175 2.0E-78
sp|P0C062|GRSA_BREBE Gramicidin S synthase 1 OS=Brevibacillus brevis GN=grsA PE=3 SV=1 1064 2114 2.0E-78
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 649 1829 3.0E-78
sp|P0C061|GRSA_ANEMI Gramicidin S synthase 1 OS=Aneurinibacillus migulanus GN=grsA PE=1 SV=1 1064 2114 3.0E-78
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 35 970 1.0E-77
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 6634 7278 2.0E-77
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 623 1835 3.0E-77
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 612 1545 4.0E-77
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 3872 4870 5.0E-77
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 655 1827 6.0E-77
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 38 1827 6.0E-77
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 3673 5038 7.0E-77
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 3673 5038 1.0E-76
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 2168 3333 2.0E-76
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 2169 3285 2.0E-76
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 6693 7625 4.0E-76
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 3652 4892 4.0E-76
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 2169 3285 5.0E-76
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 5187 6558 1.0E-75
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 2245 3369 2.0E-75
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 549 1842 2.0E-75
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 5307 6245 3.0E-75
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 5210 6409 3.0E-75
sp|Q4WMK2|NRPS9_ASPFU Nonribosomal peptide syntethase 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS9 PE=3 SV=1 6627 7256 1.0E-74
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 2127 3359 2.0E-74
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 5183 6569 2.0E-74
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 2176 3460 2.0E-74
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 3780 4697 2.0E-74
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 3642 4910 3.0E-74
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 6262 7570 4.0E-74
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 3870 4894 4.0E-74
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 2125 3363 6.0E-74
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 4097 4893 1.0E-73
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 2125 3363 4.0E-73
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 3635 4708 6.0E-73
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 3647 5007 8.0E-73
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 3781 4895 1.0E-72
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 3648 4668 1.0E-72
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 5317 6402 2.0E-72
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 654 1829 2.0E-72
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 5183 6227 3.0E-72
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 3637 4884 4.0E-72
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 6264 7622 6.0E-72
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 2169 3538 1.0E-71
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 5616 7266 1.0E-71
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 649 1835 3.0E-71
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 2169 3538 3.0E-71
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 3757 4525 1.0E-70
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 2568 3361 1.0E-70
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 655 1653 1.0E-70
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 2131 3174 9.0E-70
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 3631 4907 3.0E-69
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 2128 3258 3.0E-69
sp|P09095|TYCA_BREPA Tyrocidine synthase 1 OS=Brevibacillus parabrevis GN=tycA PE=1 SV=2 5618 6409 5.0E-69
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 5220 6223 9.0E-69
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 6244 7570 2.0E-68
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 2262 3360 2.0E-68
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 6992 7646 4.0E-68
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 5134 6286 4.0E-68
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 2589 3530 5.0E-68
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 6259 7723 3.0E-67
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 4091 4904 3.0E-67
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 679 1658 3.0E-67
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 2124 3188 3.0E-67
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 2136 3171 7.0E-67
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 6260 7622 1.0E-66
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 2130 3349 2.0E-66
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 6244 7210 5.0E-66
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 2136 3167 7.0E-66
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 2174 3404 8.0E-66
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 2119 3361 9.0E-66
sp|Q9L9G0|NOVH_STRNV Novobiocin biosynthesis protein H OS=Streptomyces niveus GN=novH PE=1 SV=2 5637 6227 9.0E-66
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 2168 2981 5.0E-65
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 2166 3207 6.0E-65
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 5418 6223 7.0E-65
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 3874 4698 8.0E-65
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 6238 7272 1.0E-64
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 6261 7570 1.0E-64
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 763 1817 1.0E-64
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 5623 6452 2.0E-64
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 6288 7316 4.0E-64
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 5315 6224 1.0E-63
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 659 1835 3.0E-63
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 4058 4871 6.0E-63
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 5310 6040 2.0E-62
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 3696 4886 5.0E-62
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 6155 7573 9.0E-62
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 3646 4079 2.0E-61
sp|P0C061|GRSA_ANEMI Gramicidin S synthase 1 OS=Aneurinibacillus migulanus GN=grsA PE=1 SV=1 5623 6402 4.0E-61
sp|P0C062|GRSA_BREBE Gramicidin S synthase 1 OS=Brevibacillus brevis GN=grsA PE=3 SV=1 5623 6402 1.0E-60
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 2492 3205 2.0E-60
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 49 951 2.0E-60
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 25 1028 3.0E-60
sp|P09095|TYCA_BREPA Tyrocidine synthase 1 OS=Brevibacillus parabrevis GN=tycA PE=1 SV=2 20 794 3.0E-60
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 6259 7307 3.0E-60
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 5308 6203 3.0E-60
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 5182 5599 5.0E-60
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 5184 6407 6.0E-60
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 3690 4938 6.0E-60
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 5222 6409 7.0E-60
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 4056 4696 1.0E-59
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 5306 6219 2.0E-59
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 6223 7280 3.0E-59
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 2506 3322 3.0E-59
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 6107 7627 3.0E-59
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 751 1829 4.0E-59
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 142 1656 4.0E-59
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 4048 4696 5.0E-59
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 5231 6193 9.0E-59
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 51 970 1.0E-58
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 655 1661 4.0E-58
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 6300 7570 7.0E-58
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 33 969 2.0E-57
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 4095 4718 3.0E-57
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 5141 6342 3.0E-57
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 5141 6342 3.0E-57
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 4067 4772 4.0E-57
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 4067 4772 4.0E-57
sp|Q9L9G0|NOVH_STRNV Novobiocin biosynthesis protein H OS=Streptomyces niveus GN=novH PE=1 SV=2 2575 3172 4.0E-57
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 14 730 5.0E-57
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 1069 1837 5.0E-57
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 2098 3178 6.0E-57
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 6263 7621 3.0E-56
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 5141 6342 5.0E-56
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 655 1824 7.0E-56
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 2596 3179 9.0E-56
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 19 969 1.0E-55
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 25 607 1.0E-55
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 4048 4864 3.0E-55
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 6368 7723 4.0E-55
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 14 791 6.0E-55
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2130 2535 7.0E-55
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 13 628 7.0E-55
sp|P0C062|GRSA_BREBE Gramicidin S synthase 1 OS=Brevibacillus brevis GN=grsA PE=3 SV=1 14 604 7.0E-55
sp|Q9L9G0|NOVH_STRNV Novobiocin biosynthesis protein H OS=Streptomyces niveus GN=novH PE=1 SV=2 31 617 7.0E-55
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 2555 3181 9.0E-55
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 689 1979 9.0E-55
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 25 518 1.0E-54
sp|Q9L9G0|NOVH_STRNV Novobiocin biosynthesis protein H OS=Streptomyces niveus GN=novH PE=1 SV=2 4090 4700 6.0E-54
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 6235 7280 8.0E-54
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 51 1037 8.0E-54
sp|P0C061|GRSA_ANEMI Gramicidin S synthase 1 OS=Aneurinibacillus migulanus GN=grsA PE=1 SV=1 14 604 1.0E-53
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 14 623 2.0E-53
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 14 624 2.0E-53
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 14 616 1.0E-52
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 14 725 2.0E-52
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 2493 3365 2.0E-52
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 2493 3365 2.0E-52
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 5916 6569 2.0E-51
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 25 620 2.0E-51
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 11 663 4.0E-51
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 2490 3172 5.0E-51
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 41 800 1.0E-50
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 29 678 2.0E-50
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 25 626 5.0E-50
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 6376 7307 1.0E-49
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 7211 7655 2.0E-49
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 38 620 2.0E-49
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 19 833 2.0E-49
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 657 1485 3.0E-49
sp|P09095|TYCA_BREPA Tyrocidine synthase 1 OS=Brevibacillus parabrevis GN=tycA PE=1 SV=2 6669 7280 4.0E-49
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 3689 4505 5.0E-49
sp|P9WQ62|MBTB_MYCTO Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mbtB PE=1 SV=1 2135 3171 5.0E-49
sp|Q7TYQ4|MBTB_MYCBO Phenyloxazoline synthase MbtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mbtB PE=3 SV=1 2135 3171 5.0E-49
sp|P9WQ63|MBTB_MYCTU Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mbtB PE=1 SV=1 2135 3171 5.0E-49
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 1076 1823 7.0E-49
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 4098 4695 1.0E-48
sp|P0DJH0|ANGR_VIBAN Anguibactin system regulator OS=Vibrio anguillarum GN=angR PE=3 SV=1 2571 3176 2.0E-48
sp|Q6W4T3|ANGR_VIBA7 Anguibactin system regulator OS=Vibrio anguillarum (strain ATCC 68554 / 775) GN=angR PE=1 SV=1 2571 3176 2.0E-48
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 6263 7282 3.0E-48
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 1077 1830 4.0E-48
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 6655 7384 6.0E-48
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 22 469 1.0E-47
sp|Q01757|ACVS_STRCL N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase (Fragment) OS=Streptomyces clavuligerus GN=pcbAB PE=3 SV=1 4033 4625 1.0E-47
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 6661 7719 2.0E-47
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 61 985 2.0E-47
sp|Q8XBV9|ENTF_ECO57 Enterobactin synthase component F OS=Escherichia coli O157:H7 GN=entF PE=3 SV=1 3927 4677 3.0E-47
sp|P11454|ENTF_ECOLI Enterobactin synthase component F OS=Escherichia coli (strain K12) GN=entF PE=1 SV=3 3927 4677 4.0E-47
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 21 635 6.0E-47
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 1063 1849 1.0E-46
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 50 951 1.0E-46
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 2126 3172 2.0E-46
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 3878 4888 2.0E-46
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 5944 7307 2.0E-46
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 2510 3329 3.0E-46
sp|P29698|ENTF_SHIFL Enterobactin synthase component F OS=Shigella flexneri GN=entF PE=3 SV=2 3927 4677 3.0E-46
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 11 619 8.0E-46
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 3655 4866 1.0E-45
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 6655 7501 4.0E-45
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 1031 1813 6.0E-45
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 998 1669 6.0E-45
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 4144 4772 1.0E-44
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 6662 7592 1.0E-44
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 5650 6579 1.0E-44
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 29 623 2.0E-44
sp|Q1B6A7|MBTB_MYCSS Phenyloxazoline synthase MbtB OS=Mycobacterium sp. (strain MCS) GN=mbtB PE=3 SV=1 2585 3171 2.0E-44
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 2571 3170 6.0E-44
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 2622 3192 7.0E-44
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 1035 1730 2.0E-43
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 3863 4696 4.0E-43
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 2168 3185 6.0E-43
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 2166 3025 7.0E-43
sp|P0C061|GRSA_ANEMI Gramicidin S synthase 1 OS=Aneurinibacillus migulanus GN=grsA PE=1 SV=1 6690 7464 7.0E-43
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 660 1662 1.0E-42
sp|P0DJH0|ANGR_VIBAN Anguibactin system regulator OS=Vibrio anguillarum GN=angR PE=3 SV=1 4095 4711 2.0E-42
sp|Q6W4T3|ANGR_VIBA7 Anguibactin system regulator OS=Vibrio anguillarum (strain ATCC 68554 / 775) GN=angR PE=1 SV=1 4095 4711 2.0E-42
sp|P0C062|GRSA_BREBE Gramicidin S synthase 1 OS=Brevibacillus brevis GN=grsA PE=3 SV=1 6690 7464 4.0E-42
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 51 668 1.0E-41
sp|Q8XBV9|ENTF_ECO57 Enterobactin synthase component F OS=Escherichia coli O157:H7 GN=entF PE=3 SV=1 5455 6223 1.0E-41
sp|P11454|ENTF_ECOLI Enterobactin synthase component F OS=Escherichia coli (strain K12) GN=entF PE=1 SV=3 2405 3171 1.0E-41
sp|P40976|LYS2_SCHPO L-2-aminoadipate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys1 PE=1 SV=3 51 651 1.0E-41
sp|P40976|LYS2_SCHPO L-2-aminoadipate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys1 PE=1 SV=3 4029 4760 1.0E-41
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 6638 7307 2.0E-41
sp|Q8XBV9|ENTF_ECO57 Enterobactin synthase component F OS=Escherichia coli O157:H7 GN=entF PE=3 SV=1 2405 3178 2.0E-41
sp|P29698|ENTF_SHIFL Enterobactin synthase component F OS=Shigella flexneri GN=entF PE=3 SV=2 2526 3178 2.0E-41
sp|Q1B6A7|MBTB_MYCSS Phenyloxazoline synthase MbtB OS=Mycobacterium sp. (strain MCS) GN=mbtB PE=3 SV=1 4096 4730 2.0E-41
sp|Q7TYQ4|MBTB_MYCBO Phenyloxazoline synthase MbtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mbtB PE=3 SV=1 4085 4742 4.0E-41
sp|P9WQ63|MBTB_MYCTU Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mbtB PE=1 SV=1 4085 4742 4.0E-41
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 6632 7610 5.0E-41
sp|P9WQ62|MBTB_MYCTO Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mbtB PE=1 SV=1 4085 4742 5.0E-41
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 6659 7281 1.0E-40
sp|P11454|ENTF_ECOLI Enterobactin synthase component F OS=Escherichia coli (strain K12) GN=entF PE=1 SV=3 5455 6223 2.0E-40
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 13 829 3.0E-40
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 3689 4721 3.0E-40
sp|O74298|LYS2_PENCH L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 2596 3181 6.0E-40
sp|O74298|LYS2_PENCH L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 5649 6254 1.0E-39
sp|O74298|LYS2_PENCH L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 4064 4698 2.0E-39
sp|Q73XY1|MBTB_MYCPA Phenyloxazoline synthase MbtB OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mbtB PE=3 SV=1 3737 4696 3.0E-39
sp|E2JA29|DDAD_ENTAG Dapdiamide synthesis protein DdaD OS=Enterobacter agglomerans GN=ddaD PE=1 SV=1 2573 3178 4.0E-39
sp|P9WQ62|MBTB_MYCTO Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mbtB PE=1 SV=1 5615 6223 5.0E-39
sp|Q7TYQ4|MBTB_MYCBO Phenyloxazoline synthase MbtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mbtB PE=3 SV=1 5615 6223 5.0E-39
sp|P9WQ63|MBTB_MYCTU Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mbtB PE=1 SV=1 5615 6223 5.0E-39
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 2168 3180 5.0E-39
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 6687 7719 9.0E-39
sp|P0DJH0|ANGR_VIBAN Anguibactin system regulator OS=Vibrio anguillarum GN=angR PE=3 SV=1 5660 6214 9.0E-39
sp|Q6W4T3|ANGR_VIBA7 Anguibactin system regulator OS=Vibrio anguillarum (strain ATCC 68554 / 775) GN=angR PE=1 SV=1 5660 6214 9.0E-39
sp|Q5HQN0|DLTA_STAEQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=dltA PE=3 SV=1 4107 4607 2.0E-38
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 23 792 3.0E-38
sp|P29698|ENTF_SHIFL Enterobactin synthase component F OS=Shigella flexneri GN=entF PE=3 SV=2 5581 6223 3.0E-38
sp|Q01757|ACVS_STRCL N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase (Fragment) OS=Streptomyces clavuligerus GN=pcbAB PE=3 SV=1 2509 3074 5.0E-38
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 6682 7690 7.0E-38
sp|Q81T97|DLTA_BACAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis GN=dltA PE=3 SV=1 5678 6132 7.0E-38
sp|C3LAH8|DLTA_BACAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=dltA PE=3 SV=1 5678 6132 7.0E-38
sp|C3P4I7|DLTA_BACAA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain A0248) GN=dltA PE=3 SV=1 5678 6132 7.0E-38
sp|B7IN64|DLTA_BACC2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain G9842) GN=dltA PE=3 SV=1 5628 6132 1.0E-37
sp|A7GMR0|DLTA_BACCN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=dltA PE=3 SV=1 30 521 1.0E-37
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 2585 3167 2.0E-37
sp|B9IUW2|DLTA_BACCQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain Q1) GN=dltA PE=3 SV=1 5689 6132 3.0E-37
sp|A7ZA74|DLTA_BACMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=dltA PE=3 SV=1 2577 3078 3.0E-37
sp|B8DEG2|DLTA_LISMH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=dltA PE=3 SV=1 4108 4603 4.0E-37
sp|Q73BD2|DLTA_BACC1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=dltA PE=3 SV=1 5689 6132 4.0E-37
sp|Q6HLH7|DLTA_BACHK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=dltA PE=3 SV=1 5678 6132 4.0E-37
sp|C1EM80|DLTA_BACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain 03BB102) GN=dltA PE=3 SV=1 5678 6132 4.0E-37
sp|B7JFV5|DLTA_BACC0 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH820) GN=dltA PE=3 SV=1 5678 6132 4.0E-37
sp|A0RBJ0|DLTA_BACAH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis (strain Al Hakam) GN=dltA PE=3 SV=1 5678 6132 4.0E-37
sp|E2JA29|DDAD_ENTAG Dapdiamide synthesis protein DdaD OS=Enterobacter agglomerans GN=ddaD PE=1 SV=1 4159 4696 5.0E-37
sp|Q81G39|DLTA_BACCR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dltA PE=1 SV=1 5689 6132 5.0E-37
sp|B7HHC6|DLTA_BACC4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain B4264) GN=dltA PE=3 SV=1 5689 6132 5.0E-37
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 6269 7288 6.0E-37
sp|Q63E02|DLTA_BACCZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ZK / E33L) GN=dltA PE=3 SV=1 5678 6132 6.0E-37
sp|Q03AZ2|DLTA_LACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain ATCC 334) GN=dltA PE=3 SV=1 4116 4602 9.0E-37
sp|B7HK95|DLTA_BACC7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH187) GN=dltA PE=3 SV=1 5689 6132 9.0E-37
sp|B3WC77|DLTA_LACCB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain BL23) GN=dltA PE=3 SV=1 4116 4602 9.0E-37
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 6457 7087 1.0E-36
sp|Q73XY1|MBTB_MYCPA Phenyloxazoline synthase MbtB OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mbtB PE=3 SV=1 2268 3172 1.0E-36
sp|B9IUW2|DLTA_BACCQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain Q1) GN=dltA PE=3 SV=1 2594 3080 1.0E-36
sp|A7ZA74|DLTA_BACMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=dltA PE=3 SV=1 5628 6132 1.0E-36
sp|Q73BD2|DLTA_BACC1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=dltA PE=3 SV=1 2594 3080 1.0E-36
sp|Q81G39|DLTA_BACCR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dltA PE=1 SV=1 2594 3080 1.0E-36
sp|B7HHC6|DLTA_BACC4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain B4264) GN=dltA PE=3 SV=1 2594 3080 1.0E-36
sp|A9VKV6|DLTA_BACWK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus weihenstephanensis (strain KBAB4) GN=dltA PE=3 SV=1 5689 6132 1.0E-36
sp|Q75BB3|LYS2_ASHGO L-2-aminoadipate reductase large subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LYS2 PE=3 SV=2 4035 4700 1.0E-36
sp|Q81T97|DLTA_BACAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis GN=dltA PE=3 SV=1 2594 3080 2.0E-36
sp|C3LAH8|DLTA_BACAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=dltA PE=3 SV=1 2594 3080 2.0E-36
sp|C3P4I7|DLTA_BACAA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain A0248) GN=dltA PE=3 SV=1 2594 3080 2.0E-36
sp|B7IN64|DLTA_BACC2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain G9842) GN=dltA PE=3 SV=1 2575 3080 2.0E-36
sp|Q6HLH7|DLTA_BACHK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=dltA PE=3 SV=1 2594 3080 2.0E-36
sp|C1EM80|DLTA_BACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain 03BB102) GN=dltA PE=3 SV=1 2594 3080 2.0E-36
sp|B7JFV5|DLTA_BACC0 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH820) GN=dltA PE=3 SV=1 2594 3080 2.0E-36
sp|A0RBJ0|DLTA_BACAH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis (strain Al Hakam) GN=dltA PE=3 SV=1 2594 3080 2.0E-36
sp|P07702|LYS2_YEAST L-2-aminoadipate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS2 PE=1 SV=2 4041 4698 2.0E-36
sp|P39581|DLTA_BACSU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus subtilis (strain 168) GN=dltA PE=1 SV=1 5650 6132 2.0E-36
sp|A0AH92|DLTA_LISW6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=dltA PE=3 SV=1 4108 4604 2.0E-36
sp|P0DJH0|ANGR_VIBAN Anguibactin system regulator OS=Vibrio anguillarum GN=angR PE=3 SV=1 38 616 3.0E-36
sp|Q6W4T3|ANGR_VIBA7 Anguibactin system regulator OS=Vibrio anguillarum (strain ATCC 68554 / 775) GN=angR PE=1 SV=1 38 616 3.0E-36
sp|A7GMR0|DLTA_BACCN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=dltA PE=3 SV=1 5689 6132 3.0E-36
sp|Q63E02|DLTA_BACCZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ZK / E33L) GN=dltA PE=3 SV=1 2594 3080 3.0E-36
sp|Q8CT93|DLTA_STAES D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=dltA PE=3 SV=1 4107 4607 3.0E-36
sp|Q721J2|DLTA_LISMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=dltA PE=3 SV=1 4108 4603 3.0E-36
sp|B7HK95|DLTA_BACC7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH187) GN=dltA PE=3 SV=1 2594 3080 4.0E-36
sp|Q1B6A7|MBTB_MYCSS Phenyloxazoline synthase MbtB OS=Mycobacterium sp. (strain MCS) GN=mbtB PE=3 SV=1 6693 7247 5.0E-36
sp|B7IN64|DLTA_BACC2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain G9842) GN=dltA PE=3 SV=1 29 521 5.0E-36
sp|Q5HQN0|DLTA_STAEQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=dltA PE=3 SV=1 2581 3078 6.0E-36
sp|C1L1P5|DLTA_LISMC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=dltA PE=3 SV=1 4108 4603 6.0E-36
sp|Q1B6A7|MBTB_MYCSS Phenyloxazoline synthase MbtB OS=Mycobacterium sp. (strain MCS) GN=mbtB PE=3 SV=1 5621 6223 7.0E-36
sp|B7HK95|DLTA_BACC7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH187) GN=dltA PE=3 SV=1 30 521 7.0E-36
sp|Q01757|ACVS_STRCL N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase (Fragment) OS=Streptomyces clavuligerus GN=pcbAB PE=3 SV=1 5576 6132 1.0E-35
sp|B9IUW2|DLTA_BACCQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain Q1) GN=dltA PE=3 SV=1 30 521 1.0E-35
sp|Q73BD2|DLTA_BACC1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=dltA PE=3 SV=1 30 521 1.0E-35
sp|Q81G39|DLTA_BACCR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dltA PE=1 SV=1 30 521 1.0E-35
sp|B7HHC6|DLTA_BACC4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain B4264) GN=dltA PE=3 SV=1 30 521 1.0E-35
sp|Q8Y8D4|DLTA_LISMO D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dltA PE=3 SV=1 4108 4603 1.0E-35
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 334 973 2.0E-35
sp|Q6HLH7|DLTA_BACHK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=dltA PE=3 SV=1 30 521 2.0E-35
sp|C1EM80|DLTA_BACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain 03BB102) GN=dltA PE=3 SV=1 30 521 2.0E-35
sp|B7JFV5|DLTA_BACC0 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH820) GN=dltA PE=3 SV=1 30 521 2.0E-35
sp|A0RBJ0|DLTA_BACAH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis (strain Al Hakam) GN=dltA PE=3 SV=1 30 521 2.0E-35
sp|Q63E02|DLTA_BACCZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ZK / E33L) GN=dltA PE=3 SV=1 30 521 2.0E-35
sp|A9VKV6|DLTA_BACWK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus weihenstephanensis (strain KBAB4) GN=dltA PE=3 SV=1 2594 3080 2.0E-35
sp|P35854|DLTA_LACRH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus rhamnosus GN=dltA PE=1 SV=1 4116 4602 2.0E-35
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 4108 4695 3.0E-35
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 5228 6214 3.0E-35
sp|Q81T97|DLTA_BACAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis GN=dltA PE=3 SV=1 30 521 3.0E-35
sp|C3LAH8|DLTA_BACAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=dltA PE=3 SV=1 30 521 3.0E-35
sp|C3P4I7|DLTA_BACAA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain A0248) GN=dltA PE=3 SV=1 30 521 3.0E-35
sp|B7IN64|DLTA_BACC2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain G9842) GN=dltA PE=3 SV=1 4098 4602 3.0E-35
sp|Q92D47|DLTA_LISIN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=dltA PE=3 SV=1 4108 4603 3.0E-35
sp|A9VKV6|DLTA_BACWK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus weihenstephanensis (strain KBAB4) GN=dltA PE=3 SV=1 4100 4602 4.0E-35
sp|O74298|LYS2_PENCH L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 49 660 5.0E-35
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 1287 1920 6.0E-35
sp|Q4L4U5|DLTA_STAHJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=dltA PE=3 SV=1 4094 4600 6.0E-35
sp|B7HK95|DLTA_BACC7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH187) GN=dltA PE=3 SV=1 4100 4602 7.0E-35
sp|P35854|DLTA_LACRH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus rhamnosus GN=dltA PE=1 SV=1 5638 6134 7.0E-35
sp|B9IUW2|DLTA_BACCQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain Q1) GN=dltA PE=3 SV=1 4100 4602 9.0E-35
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 2596 3445 1.0E-34
sp|Q9L9G0|NOVH_STRNV Novobiocin biosynthesis protein H OS=Streptomyces niveus GN=novH PE=1 SV=2 6704 7276 1.0E-34
sp|Q73BD2|DLTA_BACC1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=dltA PE=3 SV=1 4100 4602 1.0E-34
sp|A9VKV6|DLTA_BACWK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus weihenstephanensis (strain KBAB4) GN=dltA PE=3 SV=1 30 521 1.0E-34
sp|Q8CT93|DLTA_STAES D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=dltA PE=3 SV=1 2571 3078 2.0E-34
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 7203 7646 3.0E-34
sp|P39581|DLTA_BACSU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus subtilis (strain 168) GN=dltA PE=1 SV=1 2577 3078 3.0E-34
sp|Q88VM6|DLTA_LACPL D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=dltA PE=3 SV=1 4100 4600 3.0E-34
sp|Q6GIF6|DLTA_STAAR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MRSA252) GN=dltA PE=3 SV=1 2569 3078 3.0E-34
sp|Q03AZ2|DLTA_LACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain ATCC 334) GN=dltA PE=3 SV=1 5638 6134 4.0E-34
sp|P9WQ62|MBTB_MYCTO Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mbtB PE=1 SV=1 1010 1671 5.0E-34
sp|P9WQ63|MBTB_MYCTU Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mbtB PE=1 SV=1 1010 1671 5.0E-34
sp|A7GMR0|DLTA_BACCN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=dltA PE=3 SV=1 2594 3080 5.0E-34
sp|P35854|DLTA_LACRH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus rhamnosus GN=dltA PE=1 SV=1 2572 3078 5.0E-34
sp|Q7TYQ4|MBTB_MYCBO Phenyloxazoline synthase MbtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mbtB PE=3 SV=1 1010 1671 6.0E-34
sp|Q81G39|DLTA_BACCR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dltA PE=1 SV=1 4108 4602 6.0E-34
sp|B7HHC6|DLTA_BACC4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain B4264) GN=dltA PE=3 SV=1 4108 4602 6.0E-34
sp|E2JA29|DDAD_ENTAG Dapdiamide synthesis protein DdaD OS=Enterobacter agglomerans GN=ddaD PE=1 SV=1 5647 6224 7.0E-34
sp|Q81T97|DLTA_BACAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis GN=dltA PE=3 SV=1 4100 4602 7.0E-34
sp|C3LAH8|DLTA_BACAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=dltA PE=3 SV=1 4100 4602 7.0E-34
sp|C3P4I7|DLTA_BACAA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain A0248) GN=dltA PE=3 SV=1 4100 4602 7.0E-34
sp|Q6HLH7|DLTA_BACHK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=dltA PE=3 SV=1 4100 4602 7.0E-34
sp|C1EM80|DLTA_BACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain 03BB102) GN=dltA PE=3 SV=1 4100 4602 7.0E-34
sp|B7JFV5|DLTA_BACC0 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH820) GN=dltA PE=3 SV=1 4100 4602 7.0E-34
sp|A0RBJ0|DLTA_BACAH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis (strain Al Hakam) GN=dltA PE=3 SV=1 4100 4602 7.0E-34
sp|Q63E02|DLTA_BACCZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ZK / E33L) GN=dltA PE=3 SV=1 4100 4602 1.0E-33
sp|P68878|DLTA_STAAW D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MW2) GN=dltA PE=3 SV=1 2569 3078 1.0E-33
sp|A8Z1J1|DLTA_STAAT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=dltA PE=3 SV=1 2569 3078 1.0E-33
sp|Q6GAZ4|DLTA_STAAS D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MSSA476) GN=dltA PE=3 SV=1 2569 3078 1.0E-33
sp|A6QFE3|DLTA_STAAE D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Newman) GN=dltA PE=3 SV=1 2569 3078 1.0E-33
sp|Q5HHF2|DLTA_STAAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain COL) GN=dltA PE=3 SV=1 2569 3078 1.0E-33
sp|Q2YWQ8|DLTA_STAAB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=dltA PE=3 SV=1 2569 3078 1.0E-33
sp|Q2FZW6|DLTA_STAA8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain NCTC 8325) GN=dltA PE=3 SV=1 2569 3078 1.0E-33
sp|Q2FIE3|DLTA_STAA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300) GN=dltA PE=3 SV=1 2569 3078 1.0E-33
sp|A0AH92|DLTA_LISW6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=dltA PE=3 SV=1 5650 6133 2.0E-33
sp|Q65DH1|DLTA_BACLD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=dltA PE=3 SV=1 2575 3079 2.0E-33
sp|Q9L9G0|NOVH_STRNV Novobiocin biosynthesis protein H OS=Streptomyces niveus GN=novH PE=1 SV=2 1223 1653 3.0E-33
sp|B3WC77|DLTA_LACCB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain BL23) GN=dltA PE=3 SV=1 5638 6134 3.0E-33
sp|Q65DH1|DLTA_BACLD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=dltA PE=3 SV=1 30 521 3.0E-33
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 4096 4879 4.0E-33
sp|Q73XY1|MBTB_MYCPA Phenyloxazoline synthase MbtB OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mbtB PE=3 SV=1 5239 6224 4.0E-33
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 2609 3333 5.0E-33
sp|E2JA29|DDAD_ENTAG Dapdiamide synthesis protein DdaD OS=Enterobacter agglomerans GN=ddaD PE=1 SV=1 25 623 5.0E-33
sp|P07702|LYS2_YEAST L-2-aminoadipate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS2 PE=1 SV=2 2494 3176 5.0E-33
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 1223 1848 6.0E-33
sp|Q9CG49|DLTA_LACLA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=dltA PE=3 SV=1 4100 4604 6.0E-33
sp|P0C397|DLTA_STAAU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus GN=dltA PE=3 SV=1 2569 3078 7.0E-33
sp|P99107|DLTA_STAAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain N315) GN=dltA PE=1 SV=1 2569 3078 7.0E-33
sp|P68876|DLTA_STAAM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dltA PE=3 SV=1 2569 3078 7.0E-33
sp|A5IRB0|DLTA_STAA9 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH9) GN=dltA PE=3 SV=1 2569 3078 7.0E-33
sp|A6U039|DLTA_STAA2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH1) GN=dltA PE=3 SV=1 2569 3078 7.0E-33
sp|A7X0D6|DLTA_STAA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=dltA PE=3 SV=1 2569 3078 7.0E-33
sp|Q6GIF6|DLTA_STAAR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MRSA252) GN=dltA PE=3 SV=1 4106 4605 8.0E-33
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 4115 4962 9.0E-33
sp|Q03AZ2|DLTA_LACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain ATCC 334) GN=dltA PE=3 SV=1 2572 3078 9.0E-33
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 1223 1676 1.0E-32
sp|B3WC77|DLTA_LACCB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain BL23) GN=dltA PE=3 SV=1 2572 3078 1.0E-32
sp|Q9CG49|DLTA_LACLA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=dltA PE=3 SV=1 2575 3078 1.0E-32
sp|C1CB20|DLTA_STRP7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain 70585) GN=dltA PE=3 SV=1 4107 4602 1.0E-32
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 2296 3020 1.0E-32
sp|Q721J2|DLTA_LISMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=dltA PE=3 SV=1 2636 3084 2.0E-32
sp|C1L1P5|DLTA_LISMC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=dltA PE=3 SV=1 2636 3084 2.0E-32
sp|C1CNE9|DLTA_STRZP D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain P1031) GN=dltA PE=3 SV=1 4107 4602 2.0E-32
sp|P0A399|DLTA_STRR6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=dltA PE=3 SV=1 4107 4602 2.0E-32
sp|P0A398|DLTA_STRPN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=dltA PE=3 SV=1 4107 4602 2.0E-32
sp|Q04HZ7|DLTA_STRP2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=dltA PE=3 SV=1 4107 4602 2.0E-32
sp|Q6FMI5|LYS2_CANGA L-2-aminoadipate reductase large subunit OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LYS2 PE=3 SV=1 2597 3186 2.0E-32
sp|A7GMR0|DLTA_BACCN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=dltA PE=3 SV=1 4100 4602 3.0E-32
sp|P68878|DLTA_STAAW D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MW2) GN=dltA PE=3 SV=1 4106 4607 3.0E-32
sp|A8Z1J1|DLTA_STAAT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=dltA PE=3 SV=1 4106 4607 3.0E-32
sp|Q6GAZ4|DLTA_STAAS D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MSSA476) GN=dltA PE=3 SV=1 4106 4607 3.0E-32
sp|A6QFE3|DLTA_STAAE D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Newman) GN=dltA PE=3 SV=1 4106 4607 3.0E-32
sp|Q5HHF2|DLTA_STAAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain COL) GN=dltA PE=3 SV=1 4106 4607 3.0E-32
sp|Q2FZW6|DLTA_STAA8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain NCTC 8325) GN=dltA PE=3 SV=1 4106 4607 3.0E-32
sp|Q2FIE3|DLTA_STAA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300) GN=dltA PE=3 SV=1 4106 4607 3.0E-32
sp|P07702|LYS2_YEAST L-2-aminoadipate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS2 PE=1 SV=2 5625 6236 4.0E-32
sp|Q8Y8D4|DLTA_LISMO D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dltA PE=3 SV=1 2636 3084 4.0E-32
sp|Q6FMI5|LYS2_CANGA L-2-aminoadipate reductase large subunit OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LYS2 PE=3 SV=1 4030 4700 4.0E-32
sp|P0C397|DLTA_STAAU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus GN=dltA PE=3 SV=1 4106 4607 5.0E-32
sp|P99107|DLTA_STAAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain N315) GN=dltA PE=1 SV=1 4106 4607 5.0E-32
sp|P68876|DLTA_STAAM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dltA PE=3 SV=1 4106 4607 5.0E-32
sp|A5IRB0|DLTA_STAA9 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH9) GN=dltA PE=3 SV=1 4106 4607 5.0E-32
sp|A6U039|DLTA_STAA2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH1) GN=dltA PE=3 SV=1 4106 4607 5.0E-32
sp|A7X0D6|DLTA_STAA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=dltA PE=3 SV=1 4106 4607 5.0E-32
sp|B8DEG2|DLTA_LISMH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=dltA PE=3 SV=1 2636 3084 8.0E-32
sp|A7ZA74|DLTA_BACMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=dltA PE=3 SV=1 30 521 1.0E-31
sp|Q75BB3|LYS2_ASHGO L-2-aminoadipate reductase large subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LYS2 PE=3 SV=2 5659 6238 1.0E-31
sp|P35854|DLTA_LACRH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus rhamnosus GN=dltA PE=1 SV=1 30 521 1.0E-31
sp|Q2YWQ8|DLTA_STAAB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=dltA PE=3 SV=1 4106 4607 1.0E-31
sp|Q65DH1|DLTA_BACLD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=dltA PE=3 SV=1 5650 6133 1.0E-31
sp|Q01757|ACVS_STRCL N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase (Fragment) OS=Streptomyces clavuligerus GN=pcbAB PE=3 SV=1 14 521 2.0E-31
sp|Q8XBV9|ENTF_ECO57 Enterobactin synthase component F OS=Escherichia coli O157:H7 GN=entF PE=3 SV=1 29 597 2.0E-31
sp|A7ZA74|DLTA_BACMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=dltA PE=3 SV=1 4098 4600 2.0E-31
sp|Q65DH1|DLTA_BACLD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=dltA PE=3 SV=1 4098 4604 2.0E-31
sp|Q6FMI5|LYS2_CANGA L-2-aminoadipate reductase large subunit OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LYS2 PE=3 SV=1 50 619 2.0E-31
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 6713 7635 3.0E-31
sp|A0AH92|DLTA_LISW6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=dltA PE=3 SV=1 2636 3084 3.0E-31
sp|Q721J2|DLTA_LISMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=dltA PE=3 SV=1 5650 6134 3.0E-31
sp|Q4L4U5|DLTA_STAHJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=dltA PE=3 SV=1 2573 3078 3.0E-31
sp|C1CU95|DLTA_STRZT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=dltA PE=3 SV=1 4107 4602 3.0E-31
sp|B8ZQ14|DLTA_STRPJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=dltA PE=3 SV=1 4107 4602 3.0E-31
sp|P9WQ62|MBTB_MYCTO Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mbtB PE=1 SV=1 32 596 4.0E-31
sp|Q7TYQ4|MBTB_MYCBO Phenyloxazoline synthase MbtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mbtB PE=3 SV=1 32 596 4.0E-31
sp|P9WQ63|MBTB_MYCTU Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mbtB PE=1 SV=1 32 596 4.0E-31
sp|Q1B6A7|MBTB_MYCSS Phenyloxazoline synthase MbtB OS=Mycobacterium sp. (strain MCS) GN=mbtB PE=3 SV=1 38 596 4.0E-31
sp|Q03AZ2|DLTA_LACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain ATCC 334) GN=dltA PE=3 SV=1 30 521 4.0E-31
sp|P07702|LYS2_YEAST L-2-aminoadipate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS2 PE=1 SV=2 50 619 4.0E-31
sp|Q88VM6|DLTA_LACPL D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=dltA PE=3 SV=1 2577 3074 4.0E-31
sp|C1L1P5|DLTA_LISMC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=dltA PE=3 SV=1 5650 6134 5.0E-31
sp|Q5HQN0|DLTA_STAEQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=dltA PE=3 SV=1 5636 6132 6.0E-31
sp|Q92D47|DLTA_LISIN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=dltA PE=3 SV=1 2636 3084 6.0E-31
sp|C0MBD6|DLTA_STRE4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus equi subsp. equi (strain 4047) GN=dltA PE=3 SV=1 4095 4602 6.0E-31
sp|Q53526|DLTA_STRMU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=dltA PE=3 SV=4 2598 3084 8.0E-31
sp|Q8CT93|DLTA_STAES D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=dltA PE=3 SV=1 5636 6132 9.0E-31
sp|P40976|LYS2_SCHPO L-2-aminoadipate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys1 PE=1 SV=3 5650 6223 1.0E-30
sp|A7GMR0|DLTA_BACCN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=dltA PE=3 SV=1 1081 1540 1.0E-30
sp|Q6HLH7|DLTA_BACHK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=dltA PE=3 SV=1 1081 1540 1.0E-30
sp|C1EM80|DLTA_BACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain 03BB102) GN=dltA PE=3 SV=1 1081 1540 1.0E-30
sp|B7JFV5|DLTA_BACC0 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH820) GN=dltA PE=3 SV=1 1081 1540 1.0E-30
sp|A0RBJ0|DLTA_BACAH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis (strain Al Hakam) GN=dltA PE=3 SV=1 1081 1540 1.0E-30
sp|Q81G39|DLTA_BACCR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dltA PE=1 SV=1 1081 1540 1.0E-30
sp|B7HHC6|DLTA_BACC4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain B4264) GN=dltA PE=3 SV=1 1081 1540 1.0E-30
sp|B3WC77|DLTA_LACCB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain BL23) GN=dltA PE=3 SV=1 30 521 1.0E-30
sp|Q88VM6|DLTA_LACPL D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=dltA PE=3 SV=1 5651 6132 1.0E-30
sp|P9WQ62|MBTB_MYCTO Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mbtB PE=1 SV=1 6692 7254 2.0E-30
sp|Q7TYQ4|MBTB_MYCBO Phenyloxazoline synthase MbtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mbtB PE=3 SV=1 6692 7254 2.0E-30
sp|P9WQ63|MBTB_MYCTU Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mbtB PE=1 SV=1 6692 7254 2.0E-30
sp|Q5HQN0|DLTA_STAEQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=dltA PE=3 SV=1 29 522 2.0E-30
sp|Q81T97|DLTA_BACAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis GN=dltA PE=3 SV=1 1081 1540 2.0E-30
sp|C3LAH8|DLTA_BACAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=dltA PE=3 SV=1 1081 1540 2.0E-30
sp|C3P4I7|DLTA_BACAA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain A0248) GN=dltA PE=3 SV=1 1081 1540 2.0E-30
sp|Q8CT93|DLTA_STAES D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=dltA PE=3 SV=1 29 522 2.0E-30
sp|Q92D47|DLTA_LISIN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=dltA PE=3 SV=1 5650 6134 2.0E-30
sp|P11454|ENTF_ECOLI Enterobactin synthase component F OS=Escherichia coli (strain K12) GN=entF PE=1 SV=3 1019 1657 3.0E-30
sp|Q75BB3|LYS2_ASHGO L-2-aminoadipate reductase large subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LYS2 PE=3 SV=2 2597 3176 3.0E-30
sp|Q6FMI5|LYS2_CANGA L-2-aminoadipate reductase large subunit OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LYS2 PE=3 SV=1 5625 6224 3.0E-30
sp|B9IUW2|DLTA_BACCQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain Q1) GN=dltA PE=3 SV=1 1081 1540 4.0E-30
sp|B8DEG2|DLTA_LISMH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=dltA PE=3 SV=1 49 522 4.0E-30
sp|Q721J2|DLTA_LISMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=dltA PE=3 SV=1 49 522 4.0E-30
sp|Q73BD2|DLTA_BACC1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=dltA PE=3 SV=1 1081 1540 5.0E-30
sp|Q8VM67|DLTA_STRA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=dltA PE=3 SV=2 4095 4602 5.0E-30
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 5647 6535 6.0E-30
sp|B8DEG2|DLTA_LISMH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=dltA PE=3 SV=1 5650 6134 6.0E-30
sp|B3WC77|DLTA_LACCB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain BL23) GN=dltA PE=3 SV=1 1090 1538 6.0E-30
sp|A7ZA74|DLTA_BACMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=dltA PE=3 SV=1 1077 1536 7.0E-30
sp|Q63E02|DLTA_BACCZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ZK / E33L) GN=dltA PE=3 SV=1 1081 1540 7.0E-30
sp|P59591|DLTA_STRA5 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=dltA PE=3 SV=1 4095 4602 7.0E-30
sp|Q3JZ94|DLTA_STRA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=dltA PE=3 SV=1 4095 4602 7.0E-30
sp|B7IN64|DLTA_BACC2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain G9842) GN=dltA PE=3 SV=1 1077 1540 8.0E-30
sp|P35854|DLTA_LACRH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus rhamnosus GN=dltA PE=1 SV=1 1226 1538 8.0E-30
sp|Q88VM6|DLTA_LACPL D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=dltA PE=3 SV=1 30 521 8.0E-30
sp|C1L1P5|DLTA_LISMC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=dltA PE=3 SV=1 49 522 9.0E-30
sp|Q8Y8D4|DLTA_LISMO D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dltA PE=3 SV=1 5650 6134 9.0E-30
sp|Q03AZ2|DLTA_LACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain ATCC 334) GN=dltA PE=3 SV=1 1226 1538 1.0E-29
sp|B7HK95|DLTA_BACC7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH187) GN=dltA PE=3 SV=1 1081 1540 1.0E-29
sp|A9VKV6|DLTA_BACWK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus weihenstephanensis (strain KBAB4) GN=dltA PE=3 SV=1 1081 1540 1.0E-29
sp|Q4L4U5|DLTA_STAHJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=dltA PE=3 SV=1 29 522 1.0E-29
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 5175 5646 2.0E-29
sp|P11454|ENTF_ECOLI Enterobactin synthase component F OS=Escherichia coli (strain K12) GN=entF PE=1 SV=3 29 597 2.0E-29
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 650 1177 3.0E-29
sp|P29698|ENTF_SHIFL Enterobactin synthase component F OS=Shigella flexneri GN=entF PE=3 SV=2 29 597 3.0E-29
sp|P39581|DLTA_BACSU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus subtilis (strain 168) GN=dltA PE=1 SV=1 30 521 3.0E-29
sp|C1CU95|DLTA_STRZT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=dltA PE=3 SV=1 2568 3074 3.0E-29
sp|B8ZQ14|DLTA_STRPJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=dltA PE=3 SV=1 2568 3074 3.0E-29
sp|Q53526|DLTA_STRMU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=dltA PE=3 SV=4 4107 4602 3.0E-29
sp|P39581|DLTA_BACSU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus subtilis (strain 168) GN=dltA PE=1 SV=1 4108 4600 4.0E-29
sp|P40976|LYS2_SCHPO L-2-aminoadipate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys1 PE=1 SV=3 2581 3190 5.0E-29
sp|C1CB20|DLTA_STRP7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain 70585) GN=dltA PE=3 SV=1 2568 3074 5.0E-29
sp|Q53526|DLTA_STRMU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=dltA PE=3 SV=4 5636 6134 5.0E-29
sp|Q8Y8D4|DLTA_LISMO D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dltA PE=3 SV=1 49 522 6.0E-29
sp|Q92D47|DLTA_LISIN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=dltA PE=3 SV=1 49 522 6.0E-29
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 3920 4505 8.0E-29
sp|C1CNE9|DLTA_STRZP D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain P1031) GN=dltA PE=3 SV=1 2568 3074 8.0E-29
sp|P0A399|DLTA_STRR6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=dltA PE=3 SV=1 2568 3074 8.0E-29
sp|P0A398|DLTA_STRPN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=dltA PE=3 SV=1 2568 3074 8.0E-29
sp|Q04HZ7|DLTA_STRP2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=dltA PE=3 SV=1 2568 3074 8.0E-29
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 4409 4693 1.0E-28
sp|Q73XY1|MBTB_MYCPA Phenyloxazoline synthase MbtB OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mbtB PE=3 SV=1 32 622 1.0E-28
sp|A0AH92|DLTA_LISW6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=dltA PE=3 SV=1 49 522 1.0E-28
sp|Q12572|LYS2_CANAX L-2-aminoadipate reductase large subunit OS=Candida albicans GN=LYS2 PE=3 SV=2 5649 6210 2.0E-28
sp|Q1J667|DLTA_STRPF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=dltA PE=3 SV=1 4098 4602 5.0E-28
sp|Q1JLB7|DLTA_STRPC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=dltA PE=3 SV=1 4098 4602 5.0E-28
sp|Q5XBN5|DLTA_STRP6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=dltA PE=1 SV=1 4098 4602 5.0E-28
sp|Q99ZA6|DLTA_STRP1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M1 GN=dltA PE=1 SV=1 4098 4602 5.0E-28
sp|A2RE45|DLTA_STRPG D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=dltA PE=3 SV=1 4098 4602 5.0E-28
sp|Q1JGF0|DLTA_STRPD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=dltA PE=3 SV=1 4098 4602 5.0E-28
sp|Q8P0J9|DLTA_STRP8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=dltA PE=3 SV=1 4098 4602 5.0E-28
sp|Q48SZ3|DLTA_STRPM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=dltA PE=3 SV=1 4098 4602 5.0E-28
sp|Q6GIF6|DLTA_STAAR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MRSA252) GN=dltA PE=3 SV=1 34 522 6.0E-28
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 2885 3363 8.0E-28
sp|Q2YWQ8|DLTA_STAAB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=dltA PE=3 SV=1 34 522 8.0E-28
sp|Q12572|LYS2_CANAX L-2-aminoadipate reductase large subunit OS=Candida albicans GN=LYS2 PE=3 SV=2 49 609 8.0E-28
sp|P0DA65|DLTA_STRPQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=dltA PE=3 SV=1 4098 4602 8.0E-28
sp|P0DA64|DLTA_STRP3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=dltA PE=3 SV=1 4098 4602 8.0E-28
sp|Q4L4U5|DLTA_STAHJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=dltA PE=3 SV=1 5628 6130 9.0E-28
sp|B5XLX5|DLTA_STRPZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=dltA PE=3 SV=1 4095 4602 1.0E-27
sp|P68878|DLTA_STAAW D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MW2) GN=dltA PE=3 SV=1 34 522 2.0E-27
sp|A8Z1J1|DLTA_STAAT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=dltA PE=3 SV=1 34 522 2.0E-27
sp|Q6GAZ4|DLTA_STAAS D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MSSA476) GN=dltA PE=3 SV=1 34 522 2.0E-27
sp|A6QFE3|DLTA_STAAE D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Newman) GN=dltA PE=3 SV=1 34 522 2.0E-27
sp|Q5HHF2|DLTA_STAAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain COL) GN=dltA PE=3 SV=1 34 522 2.0E-27
sp|Q2FZW6|DLTA_STAA8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain NCTC 8325) GN=dltA PE=3 SV=1 34 522 2.0E-27
sp|Q2FIE3|DLTA_STAA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300) GN=dltA PE=3 SV=1 34 522 2.0E-27
sp|Q12572|LYS2_CANAX L-2-aminoadipate reductase large subunit OS=Candida albicans GN=LYS2 PE=3 SV=2 4119 4686 2.0E-27
sp|Q9X2N4|DLTA_STAXY D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus xylosus GN=dltA PE=3 SV=1 4095 4600 2.0E-27
sp|Q00868|ESYN_GIBPU Enniatin synthase (Fragment) OS=Gibberella pulicaris PE=3 SV=2 4163 4505 3.0E-27
sp|P0C397|DLTA_STAAU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus GN=dltA PE=3 SV=1 34 522 4.0E-27
sp|P99107|DLTA_STAAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain N315) GN=dltA PE=1 SV=1 34 522 4.0E-27
sp|P68876|DLTA_STAAM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dltA PE=3 SV=1 34 522 4.0E-27
sp|A5IRB0|DLTA_STAA9 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH9) GN=dltA PE=3 SV=1 34 522 4.0E-27
sp|A6U039|DLTA_STAA2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH1) GN=dltA PE=3 SV=1 34 522 4.0E-27
sp|A7X0D6|DLTA_STAA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=dltA PE=3 SV=1 34 522 4.0E-27
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 6701 7596 9.0E-27
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 6706 7590 9.0E-27
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 539 973 1.0E-26
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 1333 1834 2.0E-26
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 6160 6558 2.0E-26
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 1099 1839 2.0E-26
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 5220 6224 2.0E-26
sp|Q65DH1|DLTA_BACLD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=dltA PE=3 SV=1 1077 1539 2.0E-26
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 13 628 3.0E-26
sp|O74298|LYS2_PENCH L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 1220 1659 4.0E-26
sp|Q4L4U5|DLTA_STAHJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=dltA PE=3 SV=1 1077 1536 5.0E-26
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 6117 6556 6.0E-26
sp|Q73XY1|MBTB_MYCPA Phenyloxazoline synthase MbtB OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mbtB PE=3 SV=1 6691 7175 1.0E-25
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 5450 6105 1.0E-25
sp|P29698|ENTF_SHIFL Enterobactin synthase component F OS=Shigella flexneri GN=entF PE=3 SV=2 6638 7278 2.0E-25
sp|Q8XBV9|ENTF_ECO57 Enterobactin synthase component F OS=Escherichia coli O157:H7 GN=entF PE=3 SV=1 6638 7278 3.0E-25
sp|P35854|DLTA_LACRH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus rhamnosus GN=dltA PE=1 SV=1 6719 7183 3.0E-25
sp|Q53526|DLTA_STRMU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=dltA PE=3 SV=4 51 521 3.0E-25
sp|Q92D47|DLTA_LISIN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=dltA PE=3 SV=1 1084 1540 4.0E-25
sp|Q1J667|DLTA_STRPF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=dltA PE=3 SV=1 2569 3078 4.0E-25
sp|P0DA65|DLTA_STRPQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=dltA PE=3 SV=1 2569 3078 4.0E-25
sp|P0DA64|DLTA_STRP3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=dltA PE=3 SV=1 2569 3078 4.0E-25
sp|Q1JLB7|DLTA_STRPC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=dltA PE=3 SV=1 2569 3078 5.0E-25
sp|Q5XBN5|DLTA_STRP6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=dltA PE=1 SV=1 2569 3078 5.0E-25
sp|Q99ZA6|DLTA_STRP1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M1 GN=dltA PE=1 SV=1 2569 3078 5.0E-25
sp|A2RE45|DLTA_STRPG D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=dltA PE=3 SV=1 2569 3078 5.0E-25
sp|Q1JGF0|DLTA_STRPD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=dltA PE=3 SV=1 2569 3078 5.0E-25
sp|Q8P0J9|DLTA_STRP8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=dltA PE=3 SV=1 2569 3078 5.0E-25
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 5175 5501 6.0E-25
sp|P11454|ENTF_ECOLI Enterobactin synthase component F OS=Escherichia coli (strain K12) GN=entF PE=1 SV=3 6638 7255 6.0E-25
sp|Q8VM67|DLTA_STRA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=dltA PE=3 SV=2 5627 6134 6.0E-25
sp|Q01757|ACVS_STRCL N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase (Fragment) OS=Streptomyces clavuligerus GN=pcbAB PE=3 SV=1 6659 7174 7.0E-25
sp|Q721J2|DLTA_LISMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=dltA PE=3 SV=1 1084 1540 8.0E-25
sp|P59591|DLTA_STRA5 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=dltA PE=3 SV=1 5627 6134 8.0E-25
sp|Q3JZ94|DLTA_STRA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=dltA PE=3 SV=1 5627 6134 8.0E-25
sp|C0MBD6|DLTA_STRE4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus equi subsp. equi (strain 4047) GN=dltA PE=3 SV=1 2569 3074 9.0E-25
sp|B5XLX5|DLTA_STRPZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=dltA PE=3 SV=1 2591 3078 9.0E-25
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 3618 4089 1.0E-24
sp|C1CNE9|DLTA_STRZP D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain P1031) GN=dltA PE=3 SV=1 5641 6132 1.0E-24
sp|P0A399|DLTA_STRR6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=dltA PE=3 SV=1 5641 6132 1.0E-24
sp|P0A398|DLTA_STRPN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=dltA PE=3 SV=1 5641 6132 1.0E-24
sp|Q04HZ7|DLTA_STRP2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=dltA PE=3 SV=1 5641 6132 1.0E-24
sp|Q48SZ3|DLTA_STRPM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=dltA PE=3 SV=1 2598 3078 1.0E-24
sp|Q88VM6|DLTA_LACPL D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=dltA PE=3 SV=1 1100 1536 2.0E-24
sp|Q2YWQ8|DLTA_STAAB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=dltA PE=3 SV=1 5685 6132 2.0E-24
sp|C1CU95|DLTA_STRZT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=dltA PE=3 SV=1 5641 6132 2.0E-24
sp|B8ZQ14|DLTA_STRPJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=dltA PE=3 SV=1 5641 6132 2.0E-24
sp|P0DJH0|ANGR_VIBAN Anguibactin system regulator OS=Vibrio anguillarum GN=angR PE=3 SV=1 1069 1658 3.0E-24
sp|Q6W4T3|ANGR_VIBA7 Anguibactin system regulator OS=Vibrio anguillarum (strain ATCC 68554 / 775) GN=angR PE=1 SV=1 1069 1658 3.0E-24
sp|B8DEG2|DLTA_LISMH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=dltA PE=3 SV=1 1084 1540 3.0E-24
sp|P0C397|DLTA_STAAU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus GN=dltA PE=3 SV=1 5685 6132 3.0E-24
sp|P99107|DLTA_STAAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain N315) GN=dltA PE=1 SV=1 5685 6132 3.0E-24
sp|P68876|DLTA_STAAM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dltA PE=3 SV=1 5685 6132 3.0E-24
sp|A5IRB0|DLTA_STAA9 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH9) GN=dltA PE=3 SV=1 5685 6132 3.0E-24
sp|A6U039|DLTA_STAA2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH1) GN=dltA PE=3 SV=1 5685 6132 3.0E-24
sp|A7X0D6|DLTA_STAA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=dltA PE=3 SV=1 5685 6132 3.0E-24
sp|C1CB20|DLTA_STRP7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain 70585) GN=dltA PE=3 SV=1 5641 6132 3.0E-24
sp|Q8VM67|DLTA_STRA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=dltA PE=3 SV=2 2598 3084 3.0E-24
sp|P59591|DLTA_STRA5 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=dltA PE=3 SV=1 2598 3084 3.0E-24
sp|Q3JZ94|DLTA_STRA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=dltA PE=3 SV=1 2598 3084 3.0E-24
sp|Q1B6A7|MBTB_MYCSS Phenyloxazoline synthase MbtB OS=Mycobacterium sp. (strain MCS) GN=mbtB PE=3 SV=1 1076 1710 4.0E-24
sp|P39581|DLTA_BACSU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus subtilis (strain 168) GN=dltA PE=1 SV=1 1138 1536 4.0E-24
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 7320 7719 5.0E-24
sp|Q8Y8D4|DLTA_LISMO D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dltA PE=3 SV=1 1084 1540 5.0E-24
sp|C1L1P5|DLTA_LISMC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=dltA PE=3 SV=1 1084 1540 6.0E-24
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 553 964 7.0E-24
sp|A0AH92|DLTA_LISW6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=dltA PE=3 SV=1 1084 1539 7.0E-24
sp|B3WC77|DLTA_LACCB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain BL23) GN=dltA PE=3 SV=1 6755 7183 8.0E-24
sp|Q8CT93|DLTA_STAES D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=dltA PE=3 SV=1 1077 1536 9.0E-24
sp|P68878|DLTA_STAAW D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MW2) GN=dltA PE=3 SV=1 5685 6132 9.0E-24
sp|A8Z1J1|DLTA_STAAT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=dltA PE=3 SV=1 5685 6132 9.0E-24
sp|Q6GAZ4|DLTA_STAAS D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MSSA476) GN=dltA PE=3 SV=1 5685 6132 9.0E-24
sp|A6QFE3|DLTA_STAAE D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Newman) GN=dltA PE=3 SV=1 5685 6132 9.0E-24
sp|Q5HHF2|DLTA_STAAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain COL) GN=dltA PE=3 SV=1 5685 6132 9.0E-24
sp|Q2FZW6|DLTA_STAA8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain NCTC 8325) GN=dltA PE=3 SV=1 5685 6132 9.0E-24
sp|Q2FIE3|DLTA_STAA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300) GN=dltA PE=3 SV=1 5685 6132 9.0E-24
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 7336 7650 1.0E-23
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 487 916 1.0E-23
sp|E2JA29|DDAD_ENTAG Dapdiamide synthesis protein DdaD OS=Enterobacter agglomerans GN=ddaD PE=1 SV=1 6693 7283 1.0E-23
sp|B9IUW2|DLTA_BACCQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain Q1) GN=dltA PE=3 SV=1 6694 7183 1.0E-23
sp|Q73BD2|DLTA_BACC1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=dltA PE=3 SV=1 6694 7183 1.0E-23
sp|B7HK95|DLTA_BACC7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH187) GN=dltA PE=3 SV=1 6694 7183 1.0E-23
sp|A9VKV6|DLTA_BACWK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus weihenstephanensis (strain KBAB4) GN=dltA PE=3 SV=1 6694 7183 1.0E-23
sp|Q6GIF6|DLTA_STAAR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MRSA252) GN=dltA PE=3 SV=1 5685 6132 1.0E-23
sp|Q9CG49|DLTA_LACLA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=dltA PE=3 SV=1 5688 6132 1.0E-23
sp|Q12572|LYS2_CANAX L-2-aminoadipate reductase large subunit OS=Candida albicans GN=LYS2 PE=3 SV=2 2597 3145 1.0E-23
sp|Q1JLB7|DLTA_STRPC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=dltA PE=3 SV=1 24 521 1.0E-23
sp|Q5XBN5|DLTA_STRP6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=dltA PE=1 SV=1 24 521 1.0E-23
sp|Q99ZA6|DLTA_STRP1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M1 GN=dltA PE=1 SV=1 24 521 1.0E-23
sp|Q03AZ2|DLTA_LACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain ATCC 334) GN=dltA PE=3 SV=1 6755 7183 2.0E-23
sp|Q1J667|DLTA_STRPF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=dltA PE=3 SV=1 24 521 2.0E-23
sp|A2RE45|DLTA_STRPG D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=dltA PE=3 SV=1 24 521 2.0E-23
sp|Q1JGF0|DLTA_STRPD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=dltA PE=3 SV=1 24 521 2.0E-23
sp|Q8P0J9|DLTA_STRP8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=dltA PE=3 SV=1 24 521 2.0E-23
sp|Q48SZ3|DLTA_STRPM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=dltA PE=3 SV=1 24 521 2.0E-23
sp|P0DA65|DLTA_STRPQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=dltA PE=3 SV=1 24 521 2.0E-23
sp|P0DA64|DLTA_STRP3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=dltA PE=3 SV=1 24 521 2.0E-23
sp|B5XLX5|DLTA_STRPZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=dltA PE=3 SV=1 24 521 2.0E-23
sp|Q9X2N4|DLTA_STAXY D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus xylosus GN=dltA PE=3 SV=1 2569 3078 2.0E-23
sp|P07702|LYS2_YEAST L-2-aminoadipate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS2 PE=1 SV=2 1220 1662 3.0E-23
sp|B7IN64|DLTA_BACC2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain G9842) GN=dltA PE=3 SV=1 6694 7183 4.0E-23
sp|F4K1G2|AEE19_ARATH Putative acyl-activating enzyme 19 OS=Arabidopsis thaliana GN=At5g35930 PE=2 SV=1 2622 3206 4.0E-23
sp|Q5HQN0|DLTA_STAEQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=dltA PE=3 SV=1 1077 1536 5.0E-23
sp|A7GMR0|DLTA_BACCN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=dltA PE=3 SV=1 6694 7183 5.0E-23
sp|Q81T97|DLTA_BACAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis GN=dltA PE=3 SV=1 6694 7183 6.0E-23
sp|C3LAH8|DLTA_BACAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=dltA PE=3 SV=1 6694 7183 6.0E-23
sp|C3P4I7|DLTA_BACAA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain A0248) GN=dltA PE=3 SV=1 6694 7183 6.0E-23
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 38 623 7.0E-23
sp|Q81G39|DLTA_BACCR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dltA PE=1 SV=1 6694 7183 7.0E-23
sp|B7HHC6|DLTA_BACC4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain B4264) GN=dltA PE=3 SV=1 6694 7183 7.0E-23
sp|Q65DH1|DLTA_BACLD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=dltA PE=3 SV=1 6694 7183 7.0E-23
sp|P0DJH0|ANGR_VIBAN Anguibactin system regulator OS=Vibrio anguillarum GN=angR PE=3 SV=1 6680 7278 8.0E-23
sp|Q6W4T3|ANGR_VIBA7 Anguibactin system regulator OS=Vibrio anguillarum (strain ATCC 68554 / 775) GN=angR PE=1 SV=1 6680 7278 8.0E-23
sp|Q8XBV9|ENTF_ECO57 Enterobactin synthase component F OS=Escherichia coli O157:H7 GN=entF PE=3 SV=1 1264 1657 1.0E-22
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 1079 1678 1.0E-22
sp|P0DA65|DLTA_STRPQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=dltA PE=3 SV=1 5651 6132 1.0E-22
sp|P0DA64|DLTA_STRP3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=dltA PE=3 SV=1 5651 6132 1.0E-22
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 2104 2563 2.0E-22
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 6710 7564 2.0E-22
sp|Q63E02|DLTA_BACCZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ZK / E33L) GN=dltA PE=3 SV=1 6694 7183 2.0E-22
sp|Q00868|ESYN_GIBPU Enniatin synthase (Fragment) OS=Gibberella pulicaris PE=3 SV=2 2640 3013 2.0E-22
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 6103 6522 3.0E-22
sp|Q6HLH7|DLTA_BACHK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=dltA PE=3 SV=1 6694 7183 3.0E-22
sp|C1EM80|DLTA_BACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain 03BB102) GN=dltA PE=3 SV=1 6694 7183 3.0E-22
sp|B7JFV5|DLTA_BACC0 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH820) GN=dltA PE=3 SV=1 6694 7183 3.0E-22
sp|A0RBJ0|DLTA_BACAH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis (strain Al Hakam) GN=dltA PE=3 SV=1 6694 7183 3.0E-22
sp|Q00868|ESYN_GIBPU Enniatin synthase (Fragment) OS=Gibberella pulicaris PE=3 SV=2 5694 6036 3.0E-22
sp|Q75BB3|LYS2_ASHGO L-2-aminoadipate reductase large subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LYS2 PE=3 SV=2 1220 1664 4.0E-22
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 34 459 4.0E-22
sp|Q1JLB7|DLTA_STRPC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=dltA PE=3 SV=1 5651 6132 4.0E-22
sp|Q5XBN5|DLTA_STRP6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=dltA PE=1 SV=1 5651 6132 4.0E-22
sp|Q99ZA6|DLTA_STRP1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M1 GN=dltA PE=1 SV=1 5651 6132 4.0E-22
sp|A2RE45|DLTA_STRPG D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=dltA PE=3 SV=1 5651 6132 4.0E-22
sp|Q1JGF0|DLTA_STRPD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=dltA PE=3 SV=1 5651 6132 4.0E-22
sp|Q8P0J9|DLTA_STRP8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=dltA PE=3 SV=1 5651 6132 4.0E-22
sp|Q48SZ3|DLTA_STRPM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=dltA PE=3 SV=1 5651 6132 4.0E-22
sp|Q1J667|DLTA_STRPF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=dltA PE=3 SV=1 5651 6132 5.0E-22
sp|B5XLX5|DLTA_STRPZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=dltA PE=3 SV=1 5651 6132 5.0E-22
sp|Q75BB3|LYS2_ASHGO L-2-aminoadipate reductase large subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LYS2 PE=3 SV=2 50 619 6.0E-22
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 1083 1699 7.0E-22
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 6835 7649 1.0E-21
sp|P29698|ENTF_SHIFL Enterobactin synthase component F OS=Shigella flexneri GN=entF PE=3 SV=2 1264 1657 1.0E-21
sp|Q2YWQ8|DLTA_STAAB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=dltA PE=3 SV=1 1086 1536 1.0E-21
sp|C0MBD6|DLTA_STRE4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus equi subsp. equi (strain 4047) GN=dltA PE=3 SV=1 5651 6132 1.0E-21
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 7320 7626 2.0E-21
sp|P0C397|DLTA_STAAU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus GN=dltA PE=3 SV=1 1086 1536 2.0E-21
sp|P99107|DLTA_STAAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain N315) GN=dltA PE=1 SV=1 1086 1536 2.0E-21
sp|P68876|DLTA_STAAM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dltA PE=3 SV=1 1086 1536 2.0E-21
sp|A5IRB0|DLTA_STAA9 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH9) GN=dltA PE=3 SV=1 1086 1536 2.0E-21
sp|A6U039|DLTA_STAA2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH1) GN=dltA PE=3 SV=1 1086 1536 2.0E-21
sp|A7X0D6|DLTA_STAA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=dltA PE=3 SV=1 1086 1536 2.0E-21
sp|P80436|TRS1_STRTI Triostin synthetase I OS=Streptomyces triostinicus GN=trsA PE=1 SV=2 5622 6141 2.0E-21
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 7320 7626 3.0E-21
sp|Q6GIF6|DLTA_STAAR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MRSA252) GN=dltA PE=3 SV=1 1086 1536 3.0E-21
sp|C1CB20|DLTA_STRP7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain 70585) GN=dltA PE=3 SV=1 30 521 4.0E-21
sp|F4K1G2|AEE19_ARATH Putative acyl-activating enzyme 19 OS=Arabidopsis thaliana GN=At5g35930 PE=2 SV=1 5678 6217 4.0E-21
sp|C1CU95|DLTA_STRZT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=dltA PE=3 SV=1 30 521 6.0E-21
sp|B8ZQ14|DLTA_STRPJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=dltA PE=3 SV=1 30 521 6.0E-21
sp|Q9X2N4|DLTA_STAXY D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus xylosus GN=dltA PE=3 SV=1 38 522 6.0E-21
sp|Q00868|ESYN_GIBPU Enniatin synthase (Fragment) OS=Gibberella pulicaris PE=3 SV=2 93 453 6.0E-21
sp|Q01757|ACVS_STRCL N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase (Fragment) OS=Streptomyces clavuligerus GN=pcbAB PE=3 SV=1 1223 1538 7.0E-21
sp|P40976|LYS2_SCHPO L-2-aminoadipate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys1 PE=1 SV=3 1349 1661 7.0E-21
sp|P68878|DLTA_STAAW D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MW2) GN=dltA PE=3 SV=1 1086 1536 7.0E-21
sp|A8Z1J1|DLTA_STAAT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=dltA PE=3 SV=1 1086 1536 7.0E-21
sp|Q6GAZ4|DLTA_STAAS D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MSSA476) GN=dltA PE=3 SV=1 1086 1536 7.0E-21
sp|A6QFE3|DLTA_STAAE D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Newman) GN=dltA PE=3 SV=1 1086 1536 7.0E-21
sp|Q5HHF2|DLTA_STAAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain COL) GN=dltA PE=3 SV=1 1086 1536 7.0E-21
sp|Q2FZW6|DLTA_STAA8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain NCTC 8325) GN=dltA PE=3 SV=1 1086 1536 7.0E-21
sp|Q2FIE3|DLTA_STAA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300) GN=dltA PE=3 SV=1 1086 1536 7.0E-21
sp|C1CNE9|DLTA_STRZP D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain P1031) GN=dltA PE=3 SV=1 30 521 7.0E-21
sp|P0A399|DLTA_STRR6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=dltA PE=3 SV=1 30 521 7.0E-21
sp|P0A398|DLTA_STRPN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=dltA PE=3 SV=1 30 521 7.0E-21
sp|Q04HZ7|DLTA_STRP2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=dltA PE=3 SV=1 30 521 7.0E-21
sp|Q8VM67|DLTA_STRA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=dltA PE=3 SV=2 51 521 8.0E-21
sp|O74298|LYS2_PENCH L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 6717 7289 9.0E-21
sp|P59591|DLTA_STRA5 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=dltA PE=3 SV=1 51 521 1.0E-20
sp|Q3JZ94|DLTA_STRA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=dltA PE=3 SV=1 51 521 1.0E-20
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 6099 6389 2.0E-20
sp|E2JA29|DDAD_ENTAG Dapdiamide synthesis protein DdaD OS=Enterobacter agglomerans GN=ddaD PE=1 SV=1 1138 1653 2.0E-20
sp|C0MBD6|DLTA_STRE4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus equi subsp. equi (strain 4047) GN=dltA PE=3 SV=1 24 521 3.0E-20
sp|A0AH92|DLTA_LISW6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=dltA PE=3 SV=1 6755 7184 5.0E-20
sp|Q8CT93|DLTA_STAES D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=dltA PE=3 SV=1 6701 7178 7.0E-20
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 6715 7280 8.0E-20
sp|Q4L4U5|DLTA_STAHJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=dltA PE=3 SV=1 6697 7178 8.0E-20
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 5185 5587 1.0E-19
sp|Q5HQN0|DLTA_STAEQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=dltA PE=3 SV=1 6701 7178 1.0E-19
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 3598 4055 2.0E-19
sp|Q6FMI5|LYS2_CANGA L-2-aminoadipate reductase large subunit OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LYS2 PE=3 SV=1 6693 7275 3.0E-19
sp|Q9X2N4|DLTA_STAXY D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus xylosus GN=dltA PE=3 SV=1 5650 6132 3.0E-19
sp|F4K1G2|AEE19_ARATH Putative acyl-activating enzyme 19 OS=Arabidopsis thaliana GN=At5g35930 PE=2 SV=1 4158 4670 5.0E-19
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 6693 7282 6.0E-19
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 553 955 7.0E-19
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 5186 5519 7.0E-19
sp|Q9CG49|DLTA_LACLA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=dltA PE=3 SV=1 1224 1538 7.0E-19
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 5180 5590 1.0E-18
sp|P0C397|DLTA_STAAU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus GN=dltA PE=3 SV=1 6700 7178 1.0E-18
sp|P99107|DLTA_STAAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain N315) GN=dltA PE=1 SV=1 6700 7178 1.0E-18
sp|P68876|DLTA_STAAM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dltA PE=3 SV=1 6700 7178 1.0E-18
sp|A5IRB0|DLTA_STAA9 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH9) GN=dltA PE=3 SV=1 6700 7178 1.0E-18
sp|A6U039|DLTA_STAA2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH1) GN=dltA PE=3 SV=1 6700 7178 1.0E-18
sp|A7X0D6|DLTA_STAA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=dltA PE=3 SV=1 6700 7178 1.0E-18
sp|A7ZA74|DLTA_BACMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=dltA PE=3 SV=1 6694 7178 2.0E-18
sp|P68878|DLTA_STAAW D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MW2) GN=dltA PE=3 SV=1 6700 7178 2.0E-18
sp|A8Z1J1|DLTA_STAAT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=dltA PE=3 SV=1 6700 7178 2.0E-18
sp|Q6GAZ4|DLTA_STAAS D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MSSA476) GN=dltA PE=3 SV=1 6700 7178 2.0E-18
sp|A6QFE3|DLTA_STAAE D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Newman) GN=dltA PE=3 SV=1 6700 7178 2.0E-18
sp|Q5HHF2|DLTA_STAAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain COL) GN=dltA PE=3 SV=1 6700 7178 2.0E-18
sp|Q2FZW6|DLTA_STAA8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain NCTC 8325) GN=dltA PE=3 SV=1 6700 7178 2.0E-18
sp|Q2FIE3|DLTA_STAA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300) GN=dltA PE=3 SV=1 6700 7178 2.0E-18
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 7319 7724 3.0E-18
sp|Q73XY1|MBTB_MYCPA Phenyloxazoline synthase MbtB OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mbtB PE=3 SV=1 1064 1536 3.0E-18
sp|Q6GIF6|DLTA_STAAR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MRSA252) GN=dltA PE=3 SV=1 6700 7178 4.0E-18
sp|Q2YWQ8|DLTA_STAAB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=dltA PE=3 SV=1 6700 7178 4.0E-18
sp|Q6FMI5|LYS2_CANGA L-2-aminoadipate reductase large subunit OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LYS2 PE=3 SV=1 1220 1668 5.0E-18
sp|Q75BB3|LYS2_ASHGO L-2-aminoadipate reductase large subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LYS2 PE=3 SV=2 6718 7274 6.0E-18
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 5183 5589 1.0E-17
sp|Q5RG49|ACSF4_DANRE Acyl-CoA synthetase family member 4 OS=Danio rerio GN=aasdh PE=3 SV=1 2578 3145 1.0E-17
sp|Q12572|LYS2_CANAX L-2-aminoadipate reductase large subunit OS=Candida albicans GN=LYS2 PE=3 SV=2 1349 1627 2.0E-17
sp|C0MBD6|DLTA_STRE4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus equi subsp. equi (strain 4047) GN=dltA PE=3 SV=1 1226 1538 3.0E-17
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 7344 7626 4.0E-17
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 7208 7627 4.0E-17
sp|B8DEG2|DLTA_LISMH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=dltA PE=3 SV=1 6755 7184 4.0E-17
sp|Q8Y8D4|DLTA_LISMO D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dltA PE=3 SV=1 6755 7184 4.0E-17
sp|Q8XBV3|ENTE_ECO57 Enterobactin synthase component E OS=Escherichia coli O157:H7 GN=entE PE=3 SV=1 27 527 4.0E-17
sp|Q9CG49|DLTA_LACLA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=dltA PE=3 SV=1 6694 7178 5.0E-17
sp|P10378|ENTE_ECOLI Enterobactin synthase component E OS=Escherichia coli (strain K12) GN=entE PE=1 SV=3 27 527 5.0E-17
sp|Q721J2|DLTA_LISMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=dltA PE=3 SV=1 6755 7184 6.0E-17
sp|C1L1P5|DLTA_LISMC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=dltA PE=3 SV=1 6755 7184 8.0E-17
sp|O07610|LCFB_BACSU Long-chain-fatty-acid--CoA ligase OS=Bacillus subtilis (strain 168) GN=lcfB PE=2 SV=2 30 494 1.0E-16
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 7320 7626 2.0E-16
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 6154 6641 2.0E-16
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 3686 3990 2.0E-16
sp|Q1J667|DLTA_STRPF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=dltA PE=3 SV=1 1226 1538 2.0E-16
sp|A2RE45|DLTA_STRPG D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=dltA PE=3 SV=1 1226 1538 2.0E-16
sp|Q1JGF0|DLTA_STRPD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=dltA PE=3 SV=1 1226 1538 2.0E-16
sp|Q8P0J9|DLTA_STRP8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=dltA PE=3 SV=1 1226 1538 2.0E-16
sp|Q48SZ3|DLTA_STRPM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=dltA PE=3 SV=1 1226 1538 2.0E-16
sp|B5XLX5|DLTA_STRPZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=dltA PE=3 SV=1 1226 1538 2.0E-16
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 7318 7626 3.0E-16
sp|P40976|LYS2_SCHPO L-2-aminoadipate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys1 PE=1 SV=3 6659 7300 3.0E-16
sp|P39581|DLTA_BACSU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus subtilis (strain 168) GN=dltA PE=1 SV=1 6755 7178 3.0E-16
sp|Q92D47|DLTA_LISIN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=dltA PE=3 SV=1 6755 7184 3.0E-16
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 7315 7724 4.0E-16
sp|Q1JLB7|DLTA_STRPC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=dltA PE=3 SV=1 1226 1538 4.0E-16
sp|Q5XBN5|DLTA_STRP6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=dltA PE=1 SV=1 1226 1538 4.0E-16
sp|Q99ZA6|DLTA_STRP1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M1 GN=dltA PE=1 SV=1 1226 1538 4.0E-16
sp|P0DA65|DLTA_STRPQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=dltA PE=3 SV=1 1226 1538 4.0E-16
sp|P0DA64|DLTA_STRP3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=dltA PE=3 SV=1 1226 1538 4.0E-16
sp|Q88VM6|DLTA_LACPL D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=dltA PE=3 SV=1 6701 7183 5.0E-16
sp|Q53526|DLTA_STRMU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=dltA PE=3 SV=4 1084 1540 7.0E-16
sp|C1CB20|DLTA_STRP7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain 70585) GN=dltA PE=3 SV=1 1064 1538 9.0E-16
sp|Q8VM67|DLTA_STRA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=dltA PE=3 SV=2 1076 1540 1.0E-15
sp|F4K1G2|AEE19_ARATH Putative acyl-activating enzyme 19 OS=Arabidopsis thaliana GN=At5g35930 PE=2 SV=1 77 603 1.0E-15
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 7306 7626 2.0E-15
sp|P29698|ENTF_SHIFL Enterobactin synthase component F OS=Shigella flexneri GN=entF PE=3 SV=2 676 1180 2.0E-15
sp|C1CB20|DLTA_STRP7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain 70585) GN=dltA PE=3 SV=1 6696 7184 2.0E-15
sp|P59591|DLTA_STRA5 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=dltA PE=3 SV=1 1076 1540 2.0E-15
sp|Q3JZ94|DLTA_STRA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=dltA PE=3 SV=1 1076 1540 2.0E-15
sp|Q9I4X3|PQSA_PSEAE Anthranilate--CoA ligase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pqsA PE=1 SV=1 5658 6154 2.0E-15
sp|A8AP56|AAS_CITK8 Bifunctional protein Aas OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=aas PE=3 SV=1 4236 4513 2.0E-15
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 5173 5500 4.0E-15
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 7315 7626 4.0E-15
sp|Q4WYP0|NRPS6_ASPFU Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 2160 2441 5.0E-15
sp|Q8XBV9|ENTF_ECO57 Enterobactin synthase component F OS=Escherichia coli O157:H7 GN=entF PE=3 SV=1 676 1180 5.0E-15
sp|C1CNE9|DLTA_STRZP D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain P1031) GN=dltA PE=3 SV=1 1064 1538 5.0E-15
sp|P0A399|DLTA_STRR6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=dltA PE=3 SV=1 1064 1538 5.0E-15
sp|P0A398|DLTA_STRPN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=dltA PE=3 SV=1 1064 1538 5.0E-15
sp|Q04HZ7|DLTA_STRP2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=dltA PE=3 SV=1 1064 1538 5.0E-15
sp|P59591|DLTA_STRA5 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=dltA PE=3 SV=1 6693 7184 5.0E-15
sp|Q3JZ94|DLTA_STRA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=dltA PE=3 SV=1 6693 7184 5.0E-15
sp|P40871|DHBE_BACSU 2,3-dihydroxybenzoate-AMP ligase OS=Bacillus subtilis (strain 168) GN=dhbE PE=1 SV=2 5628 6135 5.0E-15
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 486 720 6.0E-15
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 5186 5519 6.0E-15
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 7062 7592 6.0E-15
sp|Q9CG49|DLTA_LACLA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=dltA PE=3 SV=1 34 522 6.0E-15
sp|C1CNE9|DLTA_STRZP D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain P1031) GN=dltA PE=3 SV=1 6696 7184 6.0E-15
sp|P0A399|DLTA_STRR6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=dltA PE=3 SV=1 6696 7184 6.0E-15
sp|P0A398|DLTA_STRPN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=dltA PE=3 SV=1 6696 7184 6.0E-15
sp|Q04HZ7|DLTA_STRP2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=dltA PE=3 SV=1 6696 7184 6.0E-15
sp|Q9X2N4|DLTA_STAXY D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus xylosus GN=dltA PE=3 SV=1 1286 1536 6.0E-15
sp|Q9I4X3|PQSA_PSEAE Anthranilate--CoA ligase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pqsA PE=1 SV=1 4133 4609 6.0E-15
sp|O74976|FAT2_SCHPO Putative peroxisomal-coenzyme A synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1827.03c PE=1 SV=1 5765 6144 6.0E-15
sp|Q8VM67|DLTA_STRA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=dltA PE=3 SV=2 6693 7184 8.0E-15
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 7319 7718 9.0E-15
sp|B4T503|AAS_SALNS Bifunctional protein Aas OS=Salmonella newport (strain SL254) GN=aas PE=3 SV=1 4236 4508 9.0E-15
sp|A6TDH2|AAS_KLEP7 Bifunctional protein Aas OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=aas PE=3 SV=1 4236 4513 9.0E-15
sp|Q5RG49|ACSF4_DANRE Acyl-CoA synthetase family member 4 OS=Danio rerio GN=aasdh PE=3 SV=1 4095 4670 1.0E-14
sp|Q8ZMA4|AAS_SALTY Bifunctional protein Aas OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=aas PE=3 SV=1 4236 4508 1.0E-14
sp|Q6D107|AAS_PECAS Bifunctional protein Aas OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=aas PE=3 SV=1 4227 4606 1.0E-14
sp|B5BFH6|AAS_SALPK Bifunctional protein Aas OS=Salmonella paratyphi A (strain AKU_12601) GN=aas PE=3 SV=1 4236 4508 1.0E-14
sp|Q5PEN7|AAS_SALPA Bifunctional protein Aas OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=aas PE=3 SV=1 4236 4508 1.0E-14
sp|Q8Z406|AAS_SALTI Bifunctional protein Aas OS=Salmonella typhi GN=aas PE=3 SV=1 4236 4508 1.0E-14
sp|B4TGR5|AAS_SALHS Bifunctional protein Aas OS=Salmonella heidelberg (strain SL476) GN=aas PE=3 SV=1 4236 4508 1.0E-14
sp|B5QWU2|AAS_SALEP Bifunctional protein Aas OS=Salmonella enteritidis PT4 (strain P125109) GN=aas PE=3 SV=1 4236 4508 1.0E-14
sp|B5RDY6|AAS_SALG2 Bifunctional protein Aas OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=aas PE=3 SV=1 4236 4508 1.0E-14
sp|A1JPF0|AAS_YERE8 Bifunctional protein Aas OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=aas PE=3 SV=1 4243 4606 1.0E-14
sp|B5F4V4|AAS_SALA4 Bifunctional protein Aas OS=Salmonella agona (strain SL483) GN=aas PE=3 SV=1 4236 4508 1.0E-14
sp|B4TUM9|AAS_SALSV Bifunctional protein Aas OS=Salmonella schwarzengrund (strain CVM19633) GN=aas PE=3 SV=1 4236 4508 1.0E-14
sp|A9N3H8|AAS_SALPB Bifunctional protein Aas OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=aas PE=3 SV=1 4236 4508 1.0E-14
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 653 920 2.0E-14
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 994 1186 2.0E-14
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 2135 2475 2.0E-14
sp|Q01757|ACVS_STRCL N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase (Fragment) OS=Streptomyces clavuligerus GN=pcbAB PE=3 SV=1 962 1187 2.0E-14
sp|C0PXJ8|AAS_SALPC Bifunctional protein Aas OS=Salmonella paratyphi C (strain RKS4594) GN=aas PE=3 SV=1 4236 4508 2.0E-14
sp|Q57KA7|AAS_SALCH Bifunctional protein Aas OS=Salmonella choleraesuis (strain SC-B67) GN=aas PE=3 SV=1 4236 4508 2.0E-14
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 2128 2544 3.0E-14
sp|P96575|YDAB_BACSU Putative acyl--CoA ligase YdaB OS=Bacillus subtilis (strain 168) GN=ydaB PE=3 SV=2 4094 4606 3.0E-14
sp|C1CU95|DLTA_STRZT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=dltA PE=3 SV=1 6696 7184 4.0E-14
sp|B8ZQ14|DLTA_STRPJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=dltA PE=3 SV=1 6696 7184 4.0E-14
sp|B5XUP2|AAS_KLEP3 Bifunctional protein Aas OS=Klebsiella pneumoniae (strain 342) GN=aas PE=3 SV=1 4236 4513 4.0E-14
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 2133 2565 5.0E-14
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 3652 3990 5.0E-14
sp|C1CU95|DLTA_STRZT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=dltA PE=3 SV=1 1064 1538 5.0E-14
sp|B8ZQ14|DLTA_STRPJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=dltA PE=3 SV=1 1064 1538 5.0E-14
sp|Q8XBV3|ENTE_ECO57 Enterobactin synthase component E OS=Escherichia coli O157:H7 GN=entE PE=3 SV=1 4120 4610 5.0E-14
sp|P80436|TRS1_STRTI Triostin synthetase I OS=Streptomyces triostinicus GN=trsA PE=1 SV=2 4098 4606 6.0E-14
sp|C6DE43|AAS_PECCP Bifunctional protein Aas OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=aas PE=3 SV=1 4227 4606 6.0E-14
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 7306 7625 7.0E-14
sp|B5FUB9|AAS_SALDC Bifunctional protein Aas OS=Salmonella dublin (strain CT_02021853) GN=aas PE=3 SV=1 4236 4508 8.0E-14
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 7339 7629 9.0E-14
sp|O07610|LCFB_BACSU Long-chain-fatty-acid--CoA ligase OS=Bacillus subtilis (strain 168) GN=lcfB PE=2 SV=2 2584 3079 9.0E-14
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 541 949 1.0E-13
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 1046 1180 1.0E-13
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 1046 1180 1.0E-13
sp|F4K1G2|AEE19_ARATH Putative acyl-activating enzyme 19 OS=Arabidopsis thaliana GN=At5g35930 PE=2 SV=1 1260 1624 1.0E-13
sp|Q9AJS8|3HBCL_THAAR 3-hydroxybenzoate--CoA/4-hydroxybenzoate--CoA ligase OS=Thauera aromatica GN=hcl PE=1 SV=1 2574 3079 1.0E-13
sp|B2TYQ5|AAS_SHIB3 Bifunctional protein Aas OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=aas PE=3 SV=1 4243 4513 1.0E-13
sp|P31119|AAS_ECOLI Bifunctional protein Aas OS=Escherichia coli (strain K12) GN=aas PE=1 SV=2 4243 4513 1.0E-13
sp|B1XDP2|AAS_ECODH Bifunctional protein Aas OS=Escherichia coli (strain K12 / DH10B) GN=aas PE=3 SV=1 4243 4513 1.0E-13
sp|C4ZZY9|AAS_ECOBW Bifunctional protein Aas OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=aas PE=3 SV=1 4243 4513 1.0E-13
sp|B5Z4F4|AAS_ECO5E Bifunctional protein Aas OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=aas PE=3 SV=1 4243 4513 1.0E-13
sp|Q8X6J8|AAS_ECO57 Bifunctional protein Aas OS=Escherichia coli O157:H7 GN=aas PE=3 SV=1 4243 4513 1.0E-13
sp|B1LR34|AAS_ECOSM Bifunctional protein Aas OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=aas PE=3 SV=1 4243 4513 1.0E-13
sp|B1IU08|AAS_ECOLC Bifunctional protein Aas OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=aas PE=3 SV=1 4243 4513 1.0E-13
sp|A8A3X0|AAS_ECOHS Bifunctional protein Aas OS=Escherichia coli O9:H4 (strain HS) GN=aas PE=3 SV=1 4243 4513 1.0E-13
sp|A7ZQU2|AAS_ECO24 Bifunctional protein Aas OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=aas PE=3 SV=1 4243 4513 1.0E-13
sp|Q3YY21|AAS_SHISS Bifunctional protein Aas OS=Shigella sonnei (strain Ss046) GN=aas PE=3 SV=1 4243 4513 1.0E-13
sp|B6I6W1|AAS_ECOSE Bifunctional protein Aas OS=Escherichia coli (strain SE11) GN=aas PE=3 SV=1 4243 4513 1.0E-13
sp|B7LF13|AAS_ECO55 Bifunctional protein Aas OS=Escherichia coli (strain 55989 / EAEC) GN=aas PE=3 SV=1 4243 4513 1.0E-13
sp|Q8FEA6|AAS_ECOL6 Bifunctional protein Aas OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=aas PE=3 SV=1 4243 4513 1.0E-13
sp|B7UHQ4|AAS_ECO27 Bifunctional protein Aas OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=aas PE=3 SV=1 4243 4513 1.0E-13
sp|B7LNJ2|AAS_ESCF3 Bifunctional protein Aas OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=aas PE=3 SV=1 4243 4598 1.0E-13
sp|B7N768|AAS_ECOLU Bifunctional protein Aas OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=aas PE=3 SV=1 4243 4513 1.0E-13
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 7344 7653 2.0E-13
sp|Q4WYP0|NRPS6_ASPFU Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 5221 5500 2.0E-13
sp|Q8K0L3|ACSM2_MOUSE Acyl-coenzyme A synthetase ACSM2, mitochondrial OS=Mus musculus GN=Acsm2 PE=1 SV=1 4083 4603 2.0E-13
sp|Q9VLL0|ACSF4_DROME Acyl-CoA synthetase family member 4 homolog OS=Drosophila melanogaster GN=U26 PE=2 SV=3 4152 4689 2.0E-13
sp|Q83JV7|AAS_SHIFL Bifunctional protein Aas OS=Shigella flexneri GN=aas PE=3 SV=1 4243 4513 2.0E-13
sp|Q0T128|AAS_SHIF8 Bifunctional protein Aas OS=Shigella flexneri serotype 5b (strain 8401) GN=aas PE=3 SV=1 4243 4513 2.0E-13
sp|Q1R7H5|AAS_ECOUT Bifunctional protein Aas OS=Escherichia coli (strain UTI89 / UPEC) GN=aas PE=3 SV=1 4243 4513 2.0E-13
sp|A1AF47|AAS_ECOK1 Bifunctional protein Aas OS=Escherichia coli O1:K1 / APEC GN=aas PE=3 SV=1 4243 4513 2.0E-13
sp|B7MLI2|AAS_ECO45 Bifunctional protein Aas OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=aas PE=3 SV=1 4243 4513 2.0E-13
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 3642 4070 3.0E-13
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 1076 1492 3.0E-13
sp|P80436|TRS1_STRTI Triostin synthetase I OS=Streptomyces triostinicus GN=trsA PE=1 SV=2 2573 3082 3.0E-13
sp|Q0TDZ6|AAS_ECOL5 Bifunctional protein Aas OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=aas PE=3 SV=1 4243 4598 3.0E-13
sp|B7NVY2|AAS_ECO7I Bifunctional protein Aas OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=aas PE=3 SV=1 4243 4513 3.0E-13
sp|A7MR36|AAS_CROS8 Bifunctional protein Aas OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=aas PE=3 SV=1 4236 4605 3.0E-13
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 7318 7595 4.0E-13
sp|Q5RG49|ACSF4_DANRE Acyl-CoA synthetase family member 4 OS=Danio rerio GN=aasdh PE=3 SV=1 50 590 4.0E-13
sp|A4TLD3|AAS_YERPP Bifunctional protein Aas OS=Yersinia pestis (strain Pestoides F) GN=aas PE=3 SV=1 4243 4606 4.0E-13
sp|A9R2S1|AAS_YERPG Bifunctional protein Aas OS=Yersinia pestis bv. Antiqua (strain Angola) GN=aas PE=3 SV=1 4243 4606 4.0E-13
sp|B1JQC1|AAS_YERPY Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=aas PE=3 SV=1 4243 4606 4.0E-13
sp|Q667F1|AAS_YERPS Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=aas PE=3 SV=1 4243 4606 4.0E-13
sp|B2JZ75|AAS_YERPB Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=aas PE=3 SV=1 4243 4606 4.0E-13
sp|A7FFD1|AAS_YERP3 Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=aas PE=3 SV=1 4243 4606 4.0E-13
sp|Q74RZ6|AAS_YERPE Bifunctional protein Aas OS=Yersinia pestis GN=aas PE=3 SV=2 4243 4606 4.0E-13
sp|Q1CAS8|AAS_YERPA Bifunctional protein Aas OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=aas PE=3 SV=1 4243 4606 4.0E-13
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 7355 7629 5.0E-13
sp|Q3URE1|ACSF3_MOUSE Acyl-CoA synthetase family member 3, mitochondrial OS=Mus musculus GN=Acsf3 PE=1 SV=2 48 521 5.0E-13
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 5178 5521 6.0E-13
sp|P10378|ENTE_ECOLI Enterobactin synthase component E OS=Escherichia coli (strain K12) GN=entE PE=1 SV=3 4120 4610 6.0E-13
sp|Q80WC9|ACSF4_MOUSE Acyl-CoA synthetase family member 4 OS=Mus musculus GN=Aasdh PE=2 SV=1 4239 4682 7.0E-13
sp|P38137|FAT2_YEAST Peroxisomal-coenzyme A synthetase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PCS60 PE=1 SV=1 5764 6143 8.0E-13
sp|O07610|LCFB_BACSU Long-chain-fatty-acid--CoA ligase OS=Bacillus subtilis (strain 168) GN=lcfB PE=2 SV=2 5650 6133 9.0E-13
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 7339 7723 1.0E-12
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 2134 2499 1.0E-12
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 530 971 1.0E-12
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 3639 3972 2.0E-12
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 7315 7626 2.0E-12
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 7209 7590 2.0E-12
sp|A4WE11|AAS_ENT38 Bifunctional protein Aas OS=Enterobacter sp. (strain 638) GN=aas PE=3 SV=1 4236 4513 2.0E-12
sp|P86832|CBCL2_ARTSP 4-chlorobenzoate--CoA ligase OS=Arthrobacter sp. GN=fcbA2 PE=1 SV=1 2575 2981 2.0E-12
sp|P86831|CBCL1_ARTSP 4-chlorobenzoate--CoA ligase OS=Arthrobacter sp. GN=fcbA1 PE=1 SV=1 2575 2981 2.0E-12
sp|O07899|VIBE_VIBCH Vibriobactin-specific 2,3-dihydroxybenzoate-AMP ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=vibE PE=3 SV=1 4098 4610 2.0E-12
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 7320 7693 3.0E-12
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 6151 6585 3.0E-12
sp|Q53526|DLTA_STRMU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=dltA PE=3 SV=4 6719 7184 3.0E-12
sp|Q84P21|4CLL5_ARATH 4-coumarate--CoA ligase-like 5 OS=Arabidopsis thaliana GN=4CLL5 PE=1 SV=2 2559 2985 3.0E-12
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 7179 7723 5.0E-12
sp|Q84HC5|NCSB2_STRCZ 2-hydroxy-7-methoxy-5-methyl-1-naphthoate--CoA ligase OS=Streptomyces carzinostaticus GN=ncsB2 PE=1 SV=1 4147 4611 5.0E-12
sp|P38135|FADK_ECOLI Short-chain-fatty-acid--CoA ligase OS=Escherichia coli (strain K12) GN=fadK PE=1 SV=3 4098 4604 6.0E-12
sp|Q0K844|SAUT_CUPNH Probable sulfoacetate--CoA ligase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=sauT PE=2 SV=1 2569 2959 7.0E-12
sp|P80436|TRS1_STRTI Triostin synthetase I OS=Streptomyces triostinicus GN=trsA PE=1 SV=2 41 530 9.0E-12
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 7350 7719 2.0E-11
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 3653 3988 2.0E-11
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 2114 2463 2.0E-11
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 3652 4079 2.0E-11
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 3654 3993 2.0E-11
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 445 733 2.0E-11
sp|O74976|FAT2_SCHPO Putative peroxisomal-coenzyme A synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1827.03c PE=1 SV=1 160 533 2.0E-11
sp|A6TDH2|AAS_KLEP7 Bifunctional protein Aas OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=aas PE=3 SV=1 158 517 2.0E-11
sp|Q336M7|4CLL2_ORYSJ 4-coumarate--CoA ligase-like 2 OS=Oryza sativa subsp. japonica GN=4CLL2 PE=3 SV=3 2630 2981 2.0E-11
sp|Q58DN7|ACSF3_BOVIN Acyl-CoA synthetase family member 3, mitochondrial OS=Bos taurus GN=ACSF3 PE=2 SV=1 4118 4605 2.0E-11
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 2112 2537 3.0E-11
sp|O07899|VIBE_VIBCH Vibriobactin-specific 2,3-dihydroxybenzoate-AMP ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=vibE PE=3 SV=1 2585 3079 3.0E-11
sp|Q6NUN0|ACSM5_HUMAN Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Homo sapiens GN=ACSM5 PE=1 SV=2 2710 3080 3.0E-11
sp|P58730|MENE_LISMO 2-succinylbenzoate--CoA ligase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=menE PE=3 SV=2 4121 4604 3.0E-11
sp|A8AP56|AAS_CITK8 Bifunctional protein Aas OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=aas PE=3 SV=1 158 525 4.0E-11
sp|Q7TN78|ACSM4_RAT Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Rattus norvegicus GN=Acsm4 PE=2 SV=1 4079 4603 4.0E-11
sp|O70490|ACSM2_RAT Acyl-coenzyme A synthetase ACSM2, mitochondrial OS=Rattus norvegicus GN=Acsm2 PE=2 SV=2 4083 4603 4.0E-11
sp|Q9L9F6|NOVL_STRNV 8-demethylnovobiocic acid synthase OS=Streptomyces niveus GN=novL PE=1 SV=1 2643 3083 4.0E-11
sp|Q84P23|4CLL9_ARATH 4-coumarate--CoA ligase-like 9 OS=Arabidopsis thaliana GN=4CLL9 PE=1 SV=2 2584 3013 4.0E-11
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 7316 7626 5.0E-11
sp|P0DA65|DLTA_STRPQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=dltA PE=3 SV=1 6719 7184 5.0E-11
sp|P0DA64|DLTA_STRP3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=dltA PE=3 SV=1 6719 7184 5.0E-11
sp|Q53005|4HBCL_RHOPA 4-hydroxybenzoate--CoA/benzoate--CoA ligase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=hbaA PE=1 SV=1 19 521 5.0E-11
sp|Q4L235|ACSF4_HUMAN Acyl-CoA synthetase family member 4 OS=Homo sapiens GN=AASDH PE=1 SV=3 165 596 5.0E-11
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 6263 6541 6.0E-11
sp|Q0S7V5|FAD3_RHOJR 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase OS=Rhodococcus jostii (strain RHA1) GN=fadD3 PE=1 SV=1 21 469 6.0E-11
sp|Q4WLW8|NRP11_ASPFU Nonribosomal peptide synthetase 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS11 PE=2 SV=1 2171 2470 7.0E-11
sp|Q1JLB7|DLTA_STRPC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=dltA PE=3 SV=1 6719 7184 7.0E-11
sp|Q5XBN5|DLTA_STRP6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=dltA PE=1 SV=1 6719 7184 7.0E-11
sp|Q99ZA6|DLTA_STRP1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M1 GN=dltA PE=1 SV=1 6719 7184 7.0E-11
sp|A2RE45|DLTA_STRPG D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=dltA PE=3 SV=1 6719 7184 7.0E-11
sp|Q1JGF0|DLTA_STRPD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=dltA PE=3 SV=1 6719 7184 7.0E-11
sp|Q8P0J9|DLTA_STRP8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=dltA PE=3 SV=1 6719 7184 7.0E-11
sp|Q48SZ3|DLTA_STRPM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=dltA PE=3 SV=1 6719 7184 7.0E-11
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 6694 7083 8.0E-11
sp|B5XLX5|DLTA_STRPZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=dltA PE=3 SV=1 6719 7184 8.0E-11
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 4555 4770 9.0E-11
sp|Q1J667|DLTA_STRPF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=dltA PE=3 SV=1 6719 7184 9.0E-11
sp|Q8XBV3|ENTE_ECO57 Enterobactin synthase component E OS=Escherichia coli O157:H7 GN=entE PE=3 SV=1 5642 6039 9.0E-11
sp|Q6D107|AAS_PECAS Bifunctional protein Aas OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=aas PE=3 SV=1 160 517 9.0E-11
sp|Q58DN7|ACSF3_BOVIN Acyl-CoA synthetase family member 3, mitochondrial OS=Bos taurus GN=ACSF3 PE=2 SV=1 89 521 9.0E-11
sp|B2VFS7|AAS_ERWT9 Bifunctional protein Aas OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=aas PE=3 SV=1 4227 4511 9.0E-11
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 6157 6524 1.0E-10
sp|O07610|LCFB_BACSU Long-chain-fatty-acid--CoA ligase OS=Bacillus subtilis (strain 168) GN=lcfB PE=2 SV=2 4100 4506 1.0E-10
sp|P40871|DHBE_BACSU 2,3-dihydroxybenzoate-AMP ligase OS=Bacillus subtilis (strain 168) GN=dhbE PE=1 SV=2 2588 3081 1.0E-10
sp|B4T503|AAS_SALNS Bifunctional protein Aas OS=Salmonella newport (strain SL254) GN=aas PE=3 SV=1 158 525 1.0E-10
sp|Q8ZMA4|AAS_SALTY Bifunctional protein Aas OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=aas PE=3 SV=1 158 525 1.0E-10
sp|Q8Z406|AAS_SALTI Bifunctional protein Aas OS=Salmonella typhi GN=aas PE=3 SV=1 158 525 1.0E-10
sp|B5XUP2|AAS_KLEP3 Bifunctional protein Aas OS=Klebsiella pneumoniae (strain 342) GN=aas PE=3 SV=1 158 517 1.0E-10
sp|C6DE43|AAS_PECCP Bifunctional protein Aas OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=aas PE=3 SV=1 160 517 1.0E-10
sp|Q7TN78|ACSM4_RAT Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Rattus norvegicus GN=Acsm4 PE=2 SV=1 2709 3079 1.0E-10
sp|P9WQE1|PPSE_MYCTU Phthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsE PE=1 SV=1 3105 3502 1.0E-10
sp|P9WQE0|PPSE_MYCTO Phthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsE PE=3 SV=1 3105 3502 1.0E-10
sp|P10378|ENTE_ECOLI Enterobactin synthase component E OS=Escherichia coli (strain K12) GN=entE PE=1 SV=3 5642 6039 2.0E-10
sp|Q7TXL6|PPSE_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsE PE=1 SV=1 3105 3502 2.0E-10
sp|P69451|LCFA_ECOLI Long-chain-fatty-acid--CoA ligase OS=Escherichia coli (strain K12) GN=fadD PE=1 SV=1 5614 6136 2.0E-10
sp|P69452|LCFA_ECOL6 Long-chain-fatty-acid--CoA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fadD PE=3 SV=1 5614 6136 2.0E-10
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 5181 5601 3.0E-10
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 3688 3990 3.0E-10
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 561 951 3.0E-10
sp|A8AP56|AAS_CITK8 Bifunctional protein Aas OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=aas PE=3 SV=1 2713 3080 3.0E-10
sp|O74976|FAT2_SCHPO Putative peroxisomal-coenzyme A synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1827.03c PE=1 SV=1 4236 4602 3.0E-10
sp|B5BFH6|AAS_SALPK Bifunctional protein Aas OS=Salmonella paratyphi A (strain AKU_12601) GN=aas PE=3 SV=1 158 525 3.0E-10
sp|Q5PEN7|AAS_SALPA Bifunctional protein Aas OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=aas PE=3 SV=1 158 525 3.0E-10
sp|B4TGR5|AAS_SALHS Bifunctional protein Aas OS=Salmonella heidelberg (strain SL476) GN=aas PE=3 SV=1 158 525 3.0E-10
sp|B5QWU2|AAS_SALEP Bifunctional protein Aas OS=Salmonella enteritidis PT4 (strain P125109) GN=aas PE=3 SV=1 158 525 3.0E-10
sp|B5RDY6|AAS_SALG2 Bifunctional protein Aas OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=aas PE=3 SV=1 158 525 3.0E-10
sp|B5F4V4|AAS_SALA4 Bifunctional protein Aas OS=Salmonella agona (strain SL483) GN=aas PE=3 SV=1 158 525 3.0E-10
sp|B4TUM9|AAS_SALSV Bifunctional protein Aas OS=Salmonella schwarzengrund (strain CVM19633) GN=aas PE=3 SV=1 158 525 3.0E-10
sp|A9N3H8|AAS_SALPB Bifunctional protein Aas OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=aas PE=3 SV=1 158 525 3.0E-10
sp|B5FUB9|AAS_SALDC Bifunctional protein Aas OS=Salmonella dublin (strain CT_02021853) GN=aas PE=3 SV=1 158 525 3.0E-10
sp|Q80WC9|ACSF4_MOUSE Acyl-CoA synthetase family member 4 OS=Mus musculus GN=Aasdh PE=2 SV=1 2716 3147 3.0E-10
sp|Q80W40|ACSM4_MOUSE Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Mus musculus GN=Acsm4 PE=2 SV=1 2709 3079 3.0E-10
sp|C0PXJ8|AAS_SALPC Bifunctional protein Aas OS=Salmonella paratyphi C (strain RKS4594) GN=aas PE=3 SV=1 158 525 4.0E-10
sp|Q57KA7|AAS_SALCH Bifunctional protein Aas OS=Salmonella choleraesuis (strain SC-B67) GN=aas PE=3 SV=1 158 525 4.0E-10
sp|A7MR36|AAS_CROS8 Bifunctional protein Aas OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=aas PE=3 SV=1 160 517 4.0E-10
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 5188 5529 5.0E-10
sp|Q9I4X3|PQSA_PSEAE Anthranilate--CoA ligase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pqsA PE=1 SV=1 150 521 6.0E-10
sp|Q84P21|4CLL5_ARATH 4-coumarate--CoA ligase-like 5 OS=Arabidopsis thaliana GN=4CLL5 PE=1 SV=2 5658 6058 6.0E-10
sp|Q84HC5|NCSB2_STRCZ 2-hydroxy-7-methoxy-5-methyl-1-naphthoate--CoA ligase OS=Streptomyces carzinostaticus GN=ncsB2 PE=1 SV=1 5642 6140 6.0E-10
sp|Q9L9F6|NOVL_STRNV 8-demethylnovobiocic acid synthase OS=Streptomyces niveus GN=novL PE=1 SV=1 4234 4607 7.0E-10
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 7314 7629 8.0E-10
sp|Q9VLL0|ACSF4_DROME Acyl-CoA synthetase family member 4 homolog OS=Drosophila melanogaster GN=U26 PE=2 SV=3 47 604 8.0E-10
sp|Q83JV7|AAS_SHIFL Bifunctional protein Aas OS=Shigella flexneri GN=aas PE=3 SV=1 158 525 9.0E-10
sp|Q0T128|AAS_SHIF8 Bifunctional protein Aas OS=Shigella flexneri serotype 5b (strain 8401) GN=aas PE=3 SV=1 158 525 9.0E-10
sp|A4WE11|AAS_ENT38 Bifunctional protein Aas OS=Enterobacter sp. (strain 638) GN=aas PE=3 SV=1 158 517 9.0E-10
sp|P31684|4CL1_SOLTU 4-coumarate--CoA ligase 1 OS=Solanum tuberosum GN=4CL1 PE=3 SV=1 2713 2933 9.0E-10
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 7306 7724 1.0E-09
sp|Q4WLW8|NRP11_ASPFU Nonribosomal peptide synthetase 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS11 PE=2 SV=1 5310 5519 1.0E-09
sp|Q4WYP0|NRPS6_ASPFU Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 3643 3972 1.0E-09
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 3630 3937 1.0E-09
sp|Q00868|ESYN_GIBPU Enniatin synthase (Fragment) OS=Gibberella pulicaris PE=3 SV=2 1208 1448 1.0E-09
sp|Q00868|ESYN_GIBPU Enniatin synthase (Fragment) OS=Gibberella pulicaris PE=3 SV=2 6836 7083 1.0E-09
sp|B2TYQ5|AAS_SHIB3 Bifunctional protein Aas OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=aas PE=3 SV=1 158 525 1.0E-09
sp|B7LNJ2|AAS_ESCF3 Bifunctional protein Aas OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=aas PE=3 SV=1 158 525 1.0E-09
sp|P9WQE1|PPSE_MYCTU Phthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsE PE=1 SV=1 1567 2001 1.0E-09
sp|P9WQE0|PPSE_MYCTO Phthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsE PE=3 SV=1 1567 2001 1.0E-09
sp|Q7WSH3|FADD3_COMTE 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase OS=Comamonas testosteroni GN=fadD3 PE=3 SV=1 39 521 1.0E-09
sp|Q8Z1R0|ACSA_SALTI Acetyl-coenzyme A synthetase OS=Salmonella typhi GN=acs PE=3 SV=1 4120 4607 1.0E-09
sp|Q6ZAC1|4CL5_ORYSJ Probable 4-coumarate--CoA ligase 5 OS=Oryza sativa subsp. japonica GN=4CL5 PE=2 SV=1 2567 2981 1.0E-09
sp|O24145|4CL1_TOBAC 4-coumarate--CoA ligase 1 OS=Nicotiana tabacum GN=4CL1 PE=2 SV=1 2713 2985 1.0E-09
sp|P96843|FAD3_MYCTU 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD3 PE=1 SV=1 4108 4606 1.0E-09
sp|Q9S725|4CL2_ARATH 4-coumarate--CoA ligase 2 OS=Arabidopsis thaliana GN=4CL2 PE=1 SV=2 51 527 1.0E-09
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 876 1066 2.0E-09
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 5182 5500 2.0E-09
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 7344 7626 2.0E-09
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 7344 7570 2.0E-09
sp|P40871|DHBE_BACSU 2,3-dihydroxybenzoate-AMP ligase OS=Bacillus subtilis (strain 168) GN=dhbE PE=1 SV=2 4098 4607 2.0E-09
sp|O74976|FAT2_SCHPO Putative peroxisomal-coenzyme A synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1827.03c PE=1 SV=1 2709 3075 2.0E-09
sp|B4T503|AAS_SALNS Bifunctional protein Aas OS=Salmonella newport (strain SL254) GN=aas PE=3 SV=1 2710 3080 2.0E-09
sp|Q8ZMA4|AAS_SALTY Bifunctional protein Aas OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=aas PE=3 SV=1 2710 3080 2.0E-09
sp|B5BFH6|AAS_SALPK Bifunctional protein Aas OS=Salmonella paratyphi A (strain AKU_12601) GN=aas PE=3 SV=1 2710 3080 2.0E-09
sp|Q5PEN7|AAS_SALPA Bifunctional protein Aas OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=aas PE=3 SV=1 2710 3080 2.0E-09
sp|Q8Z406|AAS_SALTI Bifunctional protein Aas OS=Salmonella typhi GN=aas PE=3 SV=1 2710 3080 2.0E-09
sp|B4TGR5|AAS_SALHS Bifunctional protein Aas OS=Salmonella heidelberg (strain SL476) GN=aas PE=3 SV=1 2710 3080 2.0E-09
sp|B5QWU2|AAS_SALEP Bifunctional protein Aas OS=Salmonella enteritidis PT4 (strain P125109) GN=aas PE=3 SV=1 2710 3080 2.0E-09
sp|B5RDY6|AAS_SALG2 Bifunctional protein Aas OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=aas PE=3 SV=1 2710 3080 2.0E-09
sp|B5F4V4|AAS_SALA4 Bifunctional protein Aas OS=Salmonella agona (strain SL483) GN=aas PE=3 SV=1 2710 3080 2.0E-09
sp|B4TUM9|AAS_SALSV Bifunctional protein Aas OS=Salmonella schwarzengrund (strain CVM19633) GN=aas PE=3 SV=1 2710 3080 2.0E-09
sp|A9N3H8|AAS_SALPB Bifunctional protein Aas OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=aas PE=3 SV=1 2710 3080 2.0E-09
sp|P31119|AAS_ECOLI Bifunctional protein Aas OS=Escherichia coli (strain K12) GN=aas PE=1 SV=2 158 525 2.0E-09
sp|B1XDP2|AAS_ECODH Bifunctional protein Aas OS=Escherichia coli (strain K12 / DH10B) GN=aas PE=3 SV=1 158 525 2.0E-09
sp|C4ZZY9|AAS_ECOBW Bifunctional protein Aas OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=aas PE=3 SV=1 158 525 2.0E-09
sp|B5Z4F4|AAS_ECO5E Bifunctional protein Aas OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=aas PE=3 SV=1 158 525 2.0E-09
sp|Q8X6J8|AAS_ECO57 Bifunctional protein Aas OS=Escherichia coli O157:H7 GN=aas PE=3 SV=1 158 525 2.0E-09
sp|B1LR34|AAS_ECOSM Bifunctional protein Aas OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=aas PE=3 SV=1 158 525 2.0E-09
sp|B1IU08|AAS_ECOLC Bifunctional protein Aas OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=aas PE=3 SV=1 158 525 2.0E-09
sp|A8A3X0|AAS_ECOHS Bifunctional protein Aas OS=Escherichia coli O9:H4 (strain HS) GN=aas PE=3 SV=1 158 525 2.0E-09
sp|A7ZQU2|AAS_ECO24 Bifunctional protein Aas OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=aas PE=3 SV=1 158 525 2.0E-09
sp|Q3YY21|AAS_SHISS Bifunctional protein Aas OS=Shigella sonnei (strain Ss046) GN=aas PE=3 SV=1 158 525 2.0E-09
sp|B6I6W1|AAS_ECOSE Bifunctional protein Aas OS=Escherichia coli (strain SE11) GN=aas PE=3 SV=1 158 525 2.0E-09
sp|B7LF13|AAS_ECO55 Bifunctional protein Aas OS=Escherichia coli (strain 55989 / EAEC) GN=aas PE=3 SV=1 158 525 2.0E-09
sp|Q8FEA6|AAS_ECOL6 Bifunctional protein Aas OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=aas PE=3 SV=1 158 525 2.0E-09
sp|B7UHQ4|AAS_ECO27 Bifunctional protein Aas OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=aas PE=3 SV=1 158 525 2.0E-09
sp|B7N768|AAS_ECOLU Bifunctional protein Aas OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=aas PE=3 SV=1 158 525 2.0E-09
sp|Q1R7H5|AAS_ECOUT Bifunctional protein Aas OS=Escherichia coli (strain UTI89 / UPEC) GN=aas PE=3 SV=1 158 525 2.0E-09
sp|A1AF47|AAS_ECOK1 Bifunctional protein Aas OS=Escherichia coli O1:K1 / APEC GN=aas PE=3 SV=1 158 525 2.0E-09
sp|B7MLI2|AAS_ECO45 Bifunctional protein Aas OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=aas PE=3 SV=1 158 525 2.0E-09
sp|Q0TDZ6|AAS_ECOL5 Bifunctional protein Aas OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=aas PE=3 SV=1 158 525 2.0E-09
sp|B7NVY2|AAS_ECO7I Bifunctional protein Aas OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=aas PE=3 SV=1 158 525 2.0E-09
sp|Q0K844|SAUT_CUPNH Probable sulfoacetate--CoA ligase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=sauT PE=2 SV=1 4243 4599 2.0E-09
sp|Q7TXL6|PPSE_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsE PE=1 SV=1 1567 2001 2.0E-09
sp|P69451|LCFA_ECOLI Long-chain-fatty-acid--CoA ligase OS=Escherichia coli (strain K12) GN=fadD PE=1 SV=1 2597 3082 2.0E-09
sp|P69452|LCFA_ECOL6 Long-chain-fatty-acid--CoA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fadD PE=3 SV=1 2597 3082 2.0E-09
sp|Q84P24|4CLL6_ARATH 4-coumarate--CoA ligase-like 6 OS=Arabidopsis thaliana GN=4CLL6 PE=2 SV=2 5651 6144 2.0E-09
sp|Q84P24|4CLL6_ARATH 4-coumarate--CoA ligase-like 6 OS=Arabidopsis thaliana GN=4CLL6 PE=2 SV=2 2624 3025 2.0E-09
sp|Q4R4Z9|ACSF2_MACFA Acyl-CoA synthetase family member 2, mitochondrial OS=Macaca fascicularis GN=ACSF2 PE=2 SV=1 4244 4604 2.0E-09
sp|Q6YYZ2|4CLL3_ORYSJ 4-coumarate--CoA ligase-like 3 OS=Oryza sativa subsp. japonica GN=4CLL3 PE=3 SV=1 2715 2981 2.0E-09
sp|Q8XDR6|LCFA_ECO57 Long-chain-fatty-acid--CoA ligase OS=Escherichia coli O157:H7 GN=fadD PE=3 SV=1 5614 6136 2.0E-09
sp|Q6AYT9|ACSM5_RAT Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Rattus norvegicus GN=Acsm5 PE=2 SV=1 2715 3080 2.0E-09
sp|Q8ZKF6|ACSA_SALTY Acetyl-coenzyme A synthetase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=acs PE=1 SV=1 4120 4607 2.0E-09
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 3639 4004 3.0E-09
sp|Q9X2N4|DLTA_STAXY D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus xylosus GN=dltA PE=3 SV=1 6754 7178 3.0E-09
sp|C0PXJ8|AAS_SALPC Bifunctional protein Aas OS=Salmonella paratyphi C (strain RKS4594) GN=aas PE=3 SV=1 2710 3080 3.0E-09
sp|Q57KA7|AAS_SALCH Bifunctional protein Aas OS=Salmonella choleraesuis (strain SC-B67) GN=aas PE=3 SV=1 2710 3080 3.0E-09
sp|P58730|MENE_LISMO 2-succinylbenzoate--CoA ligase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=menE PE=3 SV=2 162 521 3.0E-09
sp|P9WQE1|PPSE_MYCTU Phthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsE PE=1 SV=1 4630 5072 3.0E-09
sp|P9WQE0|PPSE_MYCTO Phthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsE PE=3 SV=1 4630 5072 3.0E-09
sp|Q7WSH3|FADD3_COMTE 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase OS=Comamonas testosteroni GN=fadD3 PE=3 SV=1 4119 4605 3.0E-09
sp|P96843|FAD3_MYCTU 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD3 PE=1 SV=1 23 444 3.0E-09
sp|Q10S72|4CLL4_ORYSJ 4-coumarate--CoA ligase-like 4 OS=Oryza sativa subsp. japonica GN=4CLL4 PE=2 SV=1 2715 2985 3.0E-09
sp|P9WQ51|FAC19_MYCTU Long-chain-fatty-acid--CoA/3-oxocholest-4-en-26-oate--CoA ligase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD19 PE=1 SV=1 38 519 3.0E-09
sp|P9WQ50|FAC19_MYCTO Long-chain-fatty-acid--CoA/3-oxocholest-4-en-26-oate--CoA ligase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD19 PE=3 SV=1 38 519 3.0E-09
sp|Q7TWB7|FAC19_MYCBO Long-chain-fatty-acid--CoA/3-oxocholest-4-en-26-oate--CoA ligase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fadD19 PE=3 SV=1 38 519 3.0E-09
sp|P0C5B6|4CLL4_ARATH 4-coumarate--CoA ligase-like 4 OS=Arabidopsis thaliana GN=4CLL4 PE=2 SV=1 2590 2981 3.0E-09
sp|Q4WMK2|NRPS9_ASPFU Nonribosomal peptide syntethase 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS9 PE=3 SV=1 6442 6520 4.0E-09
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 7144 7459 4.0E-09
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 3642 3973 4.0E-09
sp|Q80W40|ACSM4_MOUSE Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Mus musculus GN=Acsm4 PE=2 SV=1 4079 4603 4.0E-09
sp|P31685|4CL2_SOLTU 4-coumarate--CoA ligase 2 OS=Solanum tuberosum GN=4CL2 PE=3 SV=1 2713 2933 4.0E-09
sp|Q82EL5|ACSA_STRAW Acetyl-coenzyme A synthetase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=acsA PE=3 SV=1 4229 4620 4.0E-09
sp|Q65FT5|MENE_BACLD 2-succinylbenzoate--CoA ligase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=menE PE=3 SV=1 30 521 4.0E-09
sp|Q84P25|4CLL2_ARATH 4-coumarate--CoA ligase-like 2 OS=Arabidopsis thaliana GN=4CLL2 PE=2 SV=2 2715 2986 4.0E-09
sp|Q9SMT7|4CLLA_ARATH Oxalate--CoA ligase OS=Arabidopsis thaliana GN=AAE3 PE=1 SV=1 5649 6132 5.0E-09
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 7347 7597 6.0E-09
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 7314 7629 6.0E-09
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 5168 5500 6.0E-09
sp|Q7TXL6|PPSE_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsE PE=1 SV=1 4630 5072 6.0E-09
sp|Q92AY8|MENE_LISIN 2-succinylbenzoate--CoA ligase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=menE PE=3 SV=2 30 521 6.0E-09
sp|Q5R9G9|ACSF2_PONAB Acyl-CoA synthetase family member 2, mitochondrial OS=Pongo abelii GN=ACSF2 PE=2 SV=1 4208 4604 7.0E-09
sp|Q9S777|4CL3_ARATH 4-coumarate--CoA ligase 3 OS=Arabidopsis thaliana GN=4CL3 PE=1 SV=1 5643 6134 7.0E-09
sp|C0MBD6|DLTA_STRE4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus equi subsp. equi (strain 4047) GN=dltA PE=3 SV=1 6696 7183 8.0E-09
sp|P46450|LCFA_HAEIN Long-chain-fatty-acid--CoA ligase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fadD PE=3 SV=1 2597 2988 8.0E-09
sp|Q17QJ1|ACSF2_BOVIN Acyl-CoA synthetase family member 2, mitochondrial OS=Bos taurus GN=ACSF2 PE=2 SV=1 4163 4604 8.0E-09
sp|A6TDH2|AAS_KLEP7 Bifunctional protein Aas OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=aas PE=3 SV=1 2710 3018 9.0E-09
sp|Q6AYT9|ACSM5_RAT Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Rattus norvegicus GN=Acsm5 PE=2 SV=1 4086 4604 9.0E-09
sp|Q4WMK2|NRPS9_ASPFU Nonribosomal peptide syntethase 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS9 PE=3 SV=1 852 918 1.0E-08
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 6092 6229 1.0E-08
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 5155 5518 1.0E-08
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 6081 6352 1.0E-08
sp|Q00868|ESYN_GIBPU Enniatin synthase (Fragment) OS=Gibberella pulicaris PE=3 SV=2 6092 6229 1.0E-08
sp|Q5RG49|ACSF4_DANRE Acyl-CoA synthetase family member 4 OS=Danio rerio GN=aasdh PE=3 SV=1 1228 1643 1.0E-08
sp|B5FUB9|AAS_SALDC Bifunctional protein Aas OS=Salmonella dublin (strain CT_02021853) GN=aas PE=3 SV=1 2710 3080 1.0E-08
sp|Q8K0L3|ACSM2_MOUSE Acyl-coenzyme A synthetase ACSM2, mitochondrial OS=Mus musculus GN=Acsm2 PE=1 SV=1 5613 6134 1.0E-08
sp|B7NVY2|AAS_ECO7I Bifunctional protein Aas OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=aas PE=3 SV=1 2710 3080 1.0E-08
sp|A4TLD3|AAS_YERPP Bifunctional protein Aas OS=Yersinia pestis (strain Pestoides F) GN=aas PE=3 SV=1 163 517 1.0E-08
sp|A9R2S1|AAS_YERPG Bifunctional protein Aas OS=Yersinia pestis bv. Antiqua (strain Angola) GN=aas PE=3 SV=1 163 517 1.0E-08
sp|B1JQC1|AAS_YERPY Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=aas PE=3 SV=1 163 517 1.0E-08
sp|Q667F1|AAS_YERPS Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=aas PE=3 SV=1 163 517 1.0E-08
sp|B2JZ75|AAS_YERPB Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=aas PE=3 SV=1 163 517 1.0E-08
sp|A7FFD1|AAS_YERP3 Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=aas PE=3 SV=1 163 517 1.0E-08
sp|Q80WC9|ACSF4_MOUSE Acyl-CoA synthetase family member 4 OS=Mus musculus GN=Aasdh PE=2 SV=1 5771 6208 1.0E-08
sp|O70490|ACSM2_RAT Acyl-coenzyme A synthetase ACSM2, mitochondrial OS=Rattus norvegicus GN=Acsm2 PE=2 SV=2 5613 6134 1.0E-08
sp|B2VFS7|AAS_ERWT9 Bifunctional protein Aas OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=aas PE=3 SV=1 160 517 1.0E-08
sp|O24145|4CL1_TOBAC 4-coumarate--CoA ligase 1 OS=Nicotiana tabacum GN=4CL1 PE=2 SV=1 45 527 1.0E-08
sp|Q9LU36|4CL4_ARATH 4-coumarate--CoA ligase 4 OS=Arabidopsis thaliana GN=4CL4 PE=1 SV=1 2590 2981 1.0E-08
sp|Q96CM8|ACSF2_HUMAN Acyl-CoA synthetase family member 2, mitochondrial OS=Homo sapiens GN=ACSF2 PE=1 SV=2 4208 4604 1.0E-08
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 2117 2443 2.0E-08
sp|Q5RG49|ACSF4_DANRE Acyl-CoA synthetase family member 4 OS=Danio rerio GN=aasdh PE=3 SV=1 5673 6198 2.0E-08
sp|B5XUP2|AAS_KLEP3 Bifunctional protein Aas OS=Klebsiella pneumoniae (strain 342) GN=aas PE=3 SV=1 2710 3018 2.0E-08
sp|P31119|AAS_ECOLI Bifunctional protein Aas OS=Escherichia coli (strain K12) GN=aas PE=1 SV=2 2710 3080 2.0E-08
sp|B1XDP2|AAS_ECODH Bifunctional protein Aas OS=Escherichia coli (strain K12 / DH10B) GN=aas PE=3 SV=1 2710 3080 2.0E-08
sp|C4ZZY9|AAS_ECOBW Bifunctional protein Aas OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=aas PE=3 SV=1 2710 3080 2.0E-08
sp|B5Z4F4|AAS_ECO5E Bifunctional protein Aas OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=aas PE=3 SV=1 2710 3080 2.0E-08
sp|Q8X6J8|AAS_ECO57 Bifunctional protein Aas OS=Escherichia coli O157:H7 GN=aas PE=3 SV=1 2710 3080 2.0E-08
sp|B1LR34|AAS_ECOSM Bifunctional protein Aas OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=aas PE=3 SV=1 2710 3080 2.0E-08
sp|B1IU08|AAS_ECOLC Bifunctional protein Aas OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=aas PE=3 SV=1 2710 3080 2.0E-08
sp|A8A3X0|AAS_ECOHS Bifunctional protein Aas OS=Escherichia coli O9:H4 (strain HS) GN=aas PE=3 SV=1 2710 3080 2.0E-08
sp|A7ZQU2|AAS_ECO24 Bifunctional protein Aas OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=aas PE=3 SV=1 2710 3080 2.0E-08
sp|Q3YY21|AAS_SHISS Bifunctional protein Aas OS=Shigella sonnei (strain Ss046) GN=aas PE=3 SV=1 2710 3080 2.0E-08
sp|B6I6W1|AAS_ECOSE Bifunctional protein Aas OS=Escherichia coli (strain SE11) GN=aas PE=3 SV=1 2710 3080 2.0E-08
sp|B7LF13|AAS_ECO55 Bifunctional protein Aas OS=Escherichia coli (strain 55989 / EAEC) GN=aas PE=3 SV=1 2710 3080 2.0E-08
sp|Q8FEA6|AAS_ECOL6 Bifunctional protein Aas OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=aas PE=3 SV=1 2710 3080 2.0E-08
sp|B7UHQ4|AAS_ECO27 Bifunctional protein Aas OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=aas PE=3 SV=1 2710 3080 2.0E-08
sp|B7LNJ2|AAS_ESCF3 Bifunctional protein Aas OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=aas PE=3 SV=1 2710 3080 2.0E-08
sp|B7N768|AAS_ECOLU Bifunctional protein Aas OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=aas PE=3 SV=1 2710 3080 2.0E-08
sp|Q1R7H5|AAS_ECOUT Bifunctional protein Aas OS=Escherichia coli (strain UTI89 / UPEC) GN=aas PE=3 SV=1 2710 3080 2.0E-08
sp|A1AF47|AAS_ECOK1 Bifunctional protein Aas OS=Escherichia coli O1:K1 / APEC GN=aas PE=3 SV=1 2710 3080 2.0E-08
sp|B7MLI2|AAS_ECO45 Bifunctional protein Aas OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=aas PE=3 SV=1 2710 3080 2.0E-08
sp|Q0TDZ6|AAS_ECOL5 Bifunctional protein Aas OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=aas PE=3 SV=1 2710 3080 2.0E-08
sp|Q74RZ6|AAS_YERPE Bifunctional protein Aas OS=Yersinia pestis GN=aas PE=3 SV=2 163 517 2.0E-08
sp|Q1CAS8|AAS_YERPA Bifunctional protein Aas OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=aas PE=3 SV=1 163 517 2.0E-08
sp|Q7TN78|ACSM4_RAT Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Rattus norvegicus GN=Acsm4 PE=2 SV=1 169 521 2.0E-08
sp|Q9SMT7|4CLLA_ARATH Oxalate--CoA ligase OS=Arabidopsis thaliana GN=AAE3 PE=1 SV=1 49 519 2.0E-08
sp|Q84P26|4CLL8_ARATH 4-coumarate--CoA ligase-like 8 OS=Arabidopsis thaliana GN=4CLL8 PE=2 SV=2 70 427 2.0E-08
sp|C5D6U5|MENE_GEOSW 2-succinylbenzoate--CoA ligase OS=Geobacillus sp. (strain WCH70) GN=menE PE=3 SV=1 30 427 2.0E-08
sp|B2TYQ5|AAS_SHIB3 Bifunctional protein Aas OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=aas PE=3 SV=1 2710 3080 3.0E-08
sp|Q9L9F6|NOVL_STRNV 8-demethylnovobiocic acid synthase OS=Streptomyces niveus GN=novL PE=1 SV=1 5643 6138 3.0E-08
sp|P27550|ACSA_ECOLI Acetyl-coenzyme A synthetase OS=Escherichia coli (strain K12) GN=acs PE=1 SV=2 4229 4607 3.0E-08
sp|B2HI05|FAC19_MYCMM Long-chain-fatty-acid--CoA/3-oxocholest-4-en-26-oate--CoA ligase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=fadD19 PE=3 SV=1 38 519 3.0E-08
sp|Q8FAY8|ACSA_ECOL6 Acetyl-coenzyme A synthetase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=acs PE=3 SV=1 4229 4607 3.0E-08
sp|Q83JV7|AAS_SHIFL Bifunctional protein Aas OS=Shigella flexneri GN=aas PE=3 SV=1 2710 3080 4.0E-08
sp|Q0T128|AAS_SHIF8 Bifunctional protein Aas OS=Shigella flexneri serotype 5b (strain 8401) GN=aas PE=3 SV=1 2710 3080 4.0E-08
sp|Q3URE1|ACSF3_MOUSE Acyl-CoA synthetase family member 3, mitochondrial OS=Mus musculus GN=Acsf3 PE=1 SV=2 4118 4605 4.0E-08
sp|P38135|FADK_ECOLI Short-chain-fatty-acid--CoA ligase OS=Escherichia coli (strain K12) GN=fadK PE=1 SV=3 2582 2981 4.0E-08
sp|Q8XDR6|LCFA_ECO57 Long-chain-fatty-acid--CoA ligase OS=Escherichia coli O157:H7 GN=fadD PE=3 SV=1 2597 3082 4.0E-08
sp|O07619|YHFT_BACSU Uncharacterized acyl--CoA ligase YhfT OS=Bacillus subtilis (strain 168) GN=yhfT PE=2 SV=1 2573 3079 4.0E-08
sp|Q8BGA8|ACSM5_MOUSE Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Mus musculus GN=Acsm5 PE=1 SV=1 2703 3080 4.0E-08
sp|O68040|ACSA_RHOCB Acetyl-coenzyme A synthetase OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) GN=acsA PE=3 SV=1 4120 4608 4.0E-08
sp|Q71YZ5|MENE_LISMF 2-succinylbenzoate--CoA ligase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=menE PE=3 SV=1 4121 4506 4.0E-08
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 2598 2964 5.0E-08
sp|Q0K844|SAUT_CUPNH Probable sulfoacetate--CoA ligase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=sauT PE=2 SV=1 168 521 5.0E-08
sp|Q6NUN0|ACSM5_HUMAN Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Homo sapiens GN=ACSM5 PE=1 SV=2 4088 4603 5.0E-08
sp|Q10S72|4CLL4_ORYSJ 4-coumarate--CoA ligase-like 4 OS=Oryza sativa subsp. japonica GN=4CLL4 PE=2 SV=1 4226 4520 5.0E-08
sp|P0C7M7|ACSM4_HUMAN Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Homo sapiens GN=ACSM4 PE=2 SV=1 2709 3084 5.0E-08
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 5184 5520 6.0E-08
sp|Q336M7|4CLL2_ORYSJ 4-coumarate--CoA ligase-like 2 OS=Oryza sativa subsp. japonica GN=4CLL2 PE=3 SV=3 5650 6036 6.0E-08
sp|Q71YZ5|MENE_LISMF 2-succinylbenzoate--CoA ligase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=menE PE=3 SV=1 162 521 6.0E-08
sp|P31684|4CL1_SOLTU 4-coumarate--CoA ligase 1 OS=Solanum tuberosum GN=4CL1 PE=3 SV=1 44 527 7.0E-08
sp|Q10S72|4CLL4_ORYSJ 4-coumarate--CoA ligase-like 4 OS=Oryza sativa subsp. japonica GN=4CLL4 PE=2 SV=1 5763 6058 7.0E-08
sp|Q67W82|4CL4_ORYSJ Probable 4-coumarate--CoA ligase 4 OS=Oryza sativa subsp. japonica GN=4CL4 PE=2 SV=1 44 416 7.0E-08
sp|Q80WC9|ACSF4_MOUSE Acyl-CoA synthetase family member 4 OS=Mus musculus GN=Aasdh PE=2 SV=1 6833 7260 9.0E-08
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 2243 2451 1.0E-07
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 2115 2512 1.0E-07
sp|A6TDH2|AAS_KLEP7 Bifunctional protein Aas OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=aas PE=3 SV=1 5751 6133 1.0E-07
sp|A1JPF0|AAS_YERE8 Bifunctional protein Aas OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=aas PE=3 SV=1 163 522 1.0E-07
sp|C6DE43|AAS_PECCP Bifunctional protein Aas OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=aas PE=3 SV=1 2541 3094 1.0E-07
sp|Q7TN78|ACSM4_RAT Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Rattus norvegicus GN=Acsm4 PE=2 SV=1 5630 6133 1.0E-07
sp|O07619|YHFT_BACSU Uncharacterized acyl--CoA ligase YhfT OS=Bacillus subtilis (strain 168) GN=yhfT PE=2 SV=1 4121 4604 1.0E-07
sp|Q9I558|ACSA1_PSEAE Acetyl-coenzyme A synthetase 1 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=acsA1 PE=3 SV=1 4240 4611 1.0E-07
sp|P63521|LCFA_SALTY Long-chain-fatty-acid--CoA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fadD PE=3 SV=1 5609 6136 1.0E-07
sp|P63522|LCFA_SALTI Long-chain-fatty-acid--CoA ligase OS=Salmonella typhi GN=fadD PE=3 SV=1 5609 6136 1.0E-07
sp|Q3E6Y4|4CLL3_ARATH 4-coumarate--CoA ligase-like 3 OS=Arabidopsis thaliana GN=4CLL3 PE=2 SV=2 2667 2986 1.0E-07
sp|Q8VYJ1|MENE_ARATH 2-succinylbenzoate--CoA ligase, chloroplastic/peroxisomal OS=Arabidopsis thaliana GN=AAE14 PE=1 SV=1 161 538 1.0E-07
sp|Q6SKG1|ACSM3_RAT Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Rattus norvegicus GN=Acsm3 PE=2 SV=1 2714 3079 1.0E-07
sp|P08659|LUCI_PHOPY Luciferin 4-monooxygenase OS=Photinus pyralis PE=1 SV=1 14 416 1.0E-07
sp|O74298|LYS2_PENCH L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 1072 1161 2.0E-07
sp|F4K1G2|AEE19_ARATH Putative acyl-activating enzyme 19 OS=Arabidopsis thaliana GN=At5g35930 PE=2 SV=1 7039 7249 2.0E-07
sp|Q6D107|AAS_PECAS Bifunctional protein Aas OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=aas PE=3 SV=1 2541 3089 2.0E-07
sp|Q0K844|SAUT_CUPNH Probable sulfoacetate--CoA ligase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=sauT PE=2 SV=1 6694 7182 2.0E-07
sp|Q6NUN0|ACSM5_HUMAN Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Homo sapiens GN=ACSM5 PE=1 SV=2 5626 6134 2.0E-07
sp|B2VFS7|AAS_ERWT9 Bifunctional protein Aas OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=aas PE=3 SV=1 2563 2981 2.0E-07
sp|P0C5B6|4CLL4_ARATH 4-coumarate--CoA ligase-like 4 OS=Arabidopsis thaliana GN=4CLL4 PE=2 SV=1 70 427 2.0E-07
sp|Q69RG7|4CLL7_ORYSJ 4-coumarate--CoA ligase-like 7 OS=Oryza sativa subsp. japonica GN=4CLL7 PE=2 SV=1 4244 4602 2.0E-07
sp|A7GU88|MENE_BACCN 2-succinylbenzoate--CoA ligase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=menE PE=3 SV=1 4232 4506 2.0E-07
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 2899 3172 3.0E-07
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 4627 5157 3.0E-07
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 3027 3244 3.0E-07
sp|P0C5B6|4CLL4_ARATH 4-coumarate--CoA ligase-like 4 OS=Arabidopsis thaliana GN=4CLL4 PE=2 SV=1 5650 6055 3.0E-07
sp|Q69RG7|4CLL7_ORYSJ 4-coumarate--CoA ligase-like 7 OS=Oryza sativa subsp. japonica GN=4CLL7 PE=2 SV=1 5704 6041 3.0E-07
sp|Q6HC29|MENE_BACHK 2-succinylbenzoate--CoA ligase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=menE PE=3 SV=1 4100 4609 3.0E-07
sp|Q8VCW8|ACSF2_MOUSE Acyl-CoA synthetase family member 2, mitochondrial OS=Mus musculus GN=Acsf2 PE=1 SV=1 4208 4604 3.0E-07
sp|B7JDD6|MENE_BACC0 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain AH820) GN=menE PE=3 SV=1 4100 4609 3.0E-07
sp|Q88EH6|ACSA1_PSEPK Acetyl-coenzyme A synthetase 1 OS=Pseudomonas putida (strain KT2440) GN=acsA1 PE=3 SV=1 2718 3021 3.0E-07
sp|Q81K97|MENE_BACAN 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis GN=menE PE=3 SV=1 4100 4609 3.0E-07
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 3646 3972 4.0E-07
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 1472 1727 4.0E-07
sp|Q84P21|4CLL5_ARATH 4-coumarate--CoA ligase-like 5 OS=Arabidopsis thaliana GN=4CLL5 PE=1 SV=2 6717 7187 4.0E-07
sp|Q9S725|4CL2_ARATH 4-coumarate--CoA ligase 2 OS=Arabidopsis thaliana GN=4CL2 PE=1 SV=2 2643 2981 4.0E-07
sp|Q65FT5|MENE_BACLD 2-succinylbenzoate--CoA ligase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=menE PE=3 SV=1 4227 4602 4.0E-07
sp|P46450|LCFA_HAEIN Long-chain-fatty-acid--CoA ligase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fadD PE=3 SV=1 165 521 4.0E-07
sp|C3LB87|MENE_BACAC 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=menE PE=3 SV=1 4100 4609 4.0E-07
sp|C3PCK3|MENE_BACAA 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis (strain A0248) GN=menE PE=3 SV=1 4100 4609 4.0E-07
sp|Q8GQN9|BCLA_THAAR Benzoate--CoA ligase OS=Thauera aromatica GN=bclA PE=1 SV=1 160 521 4.0E-07
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 5220 5522 5.0E-07
sp|Q6ZAC1|4CL5_ORYSJ Probable 4-coumarate--CoA ligase 5 OS=Oryza sativa subsp. japonica GN=4CL5 PE=2 SV=1 44 427 5.0E-07
sp|O24145|4CL1_TOBAC 4-coumarate--CoA ligase 1 OS=Nicotiana tabacum GN=4CL1 PE=2 SV=1 5644 6137 5.0E-07
sp|P08659|LUCI_PHOPY Luciferin 4-monooxygenase OS=Photinus pyralis PE=1 SV=1 4121 4505 5.0E-07
sp|Q499N5|ACSF2_RAT Acyl-CoA synthetase family member 2, mitochondrial OS=Rattus norvegicus GN=Acsf2 PE=2 SV=1 4208 4505 5.0E-07
sp|Q68CK6|ACS2B_HUMAN Acyl-coenzyme A synthetase ACSM2B, mitochondrial OS=Homo sapiens GN=ACSM2B PE=1 SV=2 2709 3092 5.0E-07
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 2049 2437 6.0E-07
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 4560 4687 6.0E-07
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 7145 7411 6.0E-07
sp|Q8K0L3|ACSM2_MOUSE Acyl-coenzyme A synthetase ACSM2, mitochondrial OS=Mus musculus GN=Acsm2 PE=1 SV=1 2717 3088 6.0E-07
sp|Q632I5|MENE_BACCZ 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ZK / E33L) GN=menE PE=3 SV=1 4100 4609 6.0E-07
sp|Q00868|ESYN_GIBPU Enniatin synthase (Fragment) OS=Gibberella pulicaris PE=3 SV=2 4560 4687 7.0E-07
sp|Q92AY8|MENE_LISIN 2-succinylbenzoate--CoA ligase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=menE PE=3 SV=2 4121 4506 7.0E-07
sp|O07619|YHFT_BACSU Uncharacterized acyl--CoA ligase YhfT OS=Bacillus subtilis (strain 168) GN=yhfT PE=2 SV=1 161 525 7.0E-07
sp|Q8BGA8|ACSM5_MOUSE Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Mus musculus GN=Acsm5 PE=1 SV=1 4086 4604 7.0E-07
sp|B7HTW3|MENE_BACC7 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain AH187) GN=menE PE=3 SV=1 4100 4609 7.0E-07
sp|A0RK73|MENE_BACAH 2-succinylbenzoate--CoA ligase OS=Bacillus thuringiensis (strain Al Hakam) GN=menE PE=3 SV=1 4100 4609 7.0E-07
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 5167 5501 8.0E-07
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 1532 1830 8.0E-07
sp|O74976|FAT2_SCHPO Putative peroxisomal-coenzyme A synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1827.03c PE=1 SV=1 1236 1538 8.0E-07
sp|Q84P23|4CLL9_ARATH 4-coumarate--CoA ligase-like 9 OS=Arabidopsis thaliana GN=4CLL9 PE=1 SV=2 5643 6045 8.0E-07
sp|Q4ZQG8|ACSA_PSEU2 Acetyl-coenzyme A synthetase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=acsA PE=3 SV=1 2718 3020 8.0E-07
sp|P80436|TRS1_STRTI Triostin synthetase I OS=Streptomyces triostinicus GN=trsA PE=1 SV=2 1360 1542 9.0E-07
sp|O74976|FAT2_SCHPO Putative peroxisomal-coenzyme A synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1827.03c PE=1 SV=1 6708 7083 9.0E-07
sp|B5XUP2|AAS_KLEP3 Bifunctional protein Aas OS=Klebsiella pneumoniae (strain 342) GN=aas PE=3 SV=1 5759 6133 9.0E-07
sp|A4WE11|AAS_ENT38 Bifunctional protein Aas OS=Enterobacter sp. (strain 638) GN=aas PE=3 SV=1 2710 2981 9.0E-07
sp|Q08AH1|ACSM1_HUMAN Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Homo sapiens GN=ACSM1 PE=1 SV=1 2633 3080 9.0E-07
sp|Q6ETN3|4CL3_ORYSJ Probable 4-coumarate--CoA ligase 3 OS=Oryza sativa subsp. japonica GN=4CL3 PE=2 SV=1 44 427 9.0E-07
sp|P40871|DHBE_BACSU 2,3-dihydroxybenzoate-AMP ligase OS=Bacillus subtilis (strain 168) GN=dhbE PE=1 SV=2 1362 1552 1.0E-06
sp|P38135|FADK_ECOLI Short-chain-fatty-acid--CoA ligase OS=Escherichia coli (strain K12) GN=fadK PE=1 SV=3 5773 6133 1.0E-06
sp|P0C7M7|ACSM4_HUMAN Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Homo sapiens GN=ACSM4 PE=2 SV=1 4090 4603 1.0E-06
sp|Q3E6Y4|4CLL3_ARATH 4-coumarate--CoA ligase-like 3 OS=Arabidopsis thaliana GN=4CLL3 PE=2 SV=2 70 427 1.0E-06
sp|P41636|4CL_PINTA 4-coumarate--CoA ligase OS=Pinus taeda GN=4CL PE=2 SV=1 45 416 1.0E-06
sp|O24146|4CL2_TOBAC 4-coumarate--CoA ligase 2 OS=Nicotiana tabacum GN=4CL2 PE=2 SV=1 2598 2985 1.0E-06
sp|O24146|4CL2_TOBAC 4-coumarate--CoA ligase 2 OS=Nicotiana tabacum GN=4CL2 PE=2 SV=1 51 527 1.0E-06
sp|Q5REV5|ACSM3_PONAB Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Pongo abelii GN=ACSM3 PE=2 SV=1 4091 4604 1.0E-06
sp|Q4FVA1|ACSA_PSYA2 Acetyl-coenzyme A synthetase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=acsA PE=3 SV=1 2712 3083 1.0E-06
sp|P17814|4CL1_ORYSJ Probable 4-coumarate--CoA ligase 1 OS=Oryza sativa subsp. japonica GN=4CL1 PE=2 SV=2 95 534 1.0E-06
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 5174 5463 2.0E-06
sp|Q84HC5|NCSB2_STRCZ 2-hydroxy-7-methoxy-5-methyl-1-naphthoate--CoA ligase OS=Streptomyces carzinostaticus GN=ncsB2 PE=1 SV=1 7 531 2.0E-06
sp|Q84P23|4CLL9_ARATH 4-coumarate--CoA ligase-like 9 OS=Arabidopsis thaliana GN=4CLL9 PE=1 SV=2 4132 4506 2.0E-06
sp|Q53005|4HBCL_RHOPA 4-hydroxybenzoate--CoA/benzoate--CoA ligase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=hbaA PE=1 SV=1 1287 1541 2.0E-06
sp|P69451|LCFA_ECOLI Long-chain-fatty-acid--CoA ligase OS=Escherichia coli (strain K12) GN=fadD PE=1 SV=1 4090 4613 2.0E-06
sp|P69452|LCFA_ECOL6 Long-chain-fatty-acid--CoA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fadD PE=3 SV=1 4090 4613 2.0E-06
sp|P31685|4CL2_SOLTU 4-coumarate--CoA ligase 2 OS=Solanum tuberosum GN=4CL2 PE=3 SV=1 44 527 2.0E-06
sp|A9VM74|MENE_BACWK 2-succinylbenzoate--CoA ligase OS=Bacillus weihenstephanensis (strain KBAB4) GN=menE PE=3 SV=1 4100 4609 2.0E-06
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 2135 2566 3.0E-06
sp|A1JPF0|AAS_YERE8 Bifunctional protein Aas OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=aas PE=3 SV=1 2563 3074 3.0E-06
sp|C6DE43|AAS_PECCP Bifunctional protein Aas OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=aas PE=3 SV=1 5762 6136 3.0E-06
sp|P86832|CBCL2_ARTSP 4-chlorobenzoate--CoA ligase OS=Arthrobacter sp. GN=fcbA2 PE=1 SV=1 5690 6037 3.0E-06
sp|P86831|CBCL1_ARTSP 4-chlorobenzoate--CoA ligase OS=Arthrobacter sp. GN=fcbA1 PE=1 SV=1 5690 6037 3.0E-06
sp|Q816I1|MENE_BACCR 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=menE PE=3 SV=1 4100 4609 3.0E-06
sp|B9J2F2|MENE_BACCQ 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain Q1) GN=menE PE=3 SV=1 4100 4609 3.0E-06
sp|A4VKA0|ACSA_PSEU5 Acetyl-coenzyme A synthetase OS=Pseudomonas stutzeri (strain A1501) GN=acsA PE=3 SV=1 2705 2981 3.0E-06
sp|Q4WLW8|NRP11_ASPFU Nonribosomal peptide synthetase 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS11 PE=2 SV=1 3693 3990 4.0E-06
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 7317 7667 4.0E-06
sp|Q336M7|4CLL2_ORYSJ 4-coumarate--CoA ligase-like 2 OS=Oryza sativa subsp. japonica GN=4CLL2 PE=3 SV=3 50 433 4.0E-06
sp|P58730|MENE_LISMO 2-succinylbenzoate--CoA ligase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=menE PE=3 SV=2 5773 6133 4.0E-06
sp|Q65FT5|MENE_BACLD 2-succinylbenzoate--CoA ligase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=menE PE=3 SV=1 6706 7178 4.0E-06
sp|Q67W82|4CL4_ORYSJ Probable 4-coumarate--CoA ligase 4 OS=Oryza sativa subsp. japonica GN=4CL4 PE=2 SV=1 5650 6137 4.0E-06
sp|Q499N5|ACSF2_RAT Acyl-CoA synthetase family member 2, mitochondrial OS=Rattus norvegicus GN=Acsf2 PE=2 SV=1 169 521 4.0E-06
sp|Q9JID6|ACSL1_CAVPO Long-chain-fatty-acid--CoA ligase 1 OS=Cavia porcellus GN=ACSL1 PE=2 SV=1 4347 4543 4.0E-06
sp|P23971|MENE_BACSU 2-succinylbenzoate--CoA ligase OS=Bacillus subtilis (strain 168) GN=menE PE=1 SV=2 5773 6135 4.0E-06
sp|O07899|VIBE_VIBCH Vibriobactin-specific 2,3-dihydroxybenzoate-AMP ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=vibE PE=3 SV=1 99 521 6.0E-06
sp|P9WQ61|FAA22_MYCTU p-hydroxybenzoic acid--AMP ligase FadD22 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD22 PE=1 SV=1 4239 4608 6.0E-06
sp|P9WQ60|FAA22_MYCTO p-hydroxybenzoic acid--AMP ligase FadD22 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD22 PE=3 SV=1 4239 4608 6.0E-06
sp|Q7TXK7|FAA22_MYCBO p-hydroxybenzoic acid--AMP ligase FadD22 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fadD22 PE=1 SV=1 4239 4608 6.0E-06
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 6160 6532 7.0E-06
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 2126 2510 8.0E-06
sp|O24540|4CL_VANPL 4-coumarate--CoA ligase OS=Vanilla planifolia GN=4CL PE=3 SV=1 169 416 8.0E-06
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 7241 7592 9.0E-06
sp|A1JPF0|AAS_YERE8 Bifunctional protein Aas OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=aas PE=3 SV=1 5768 6138 9.0E-06
sp|P9WQ61|FAA22_MYCTU p-hydroxybenzoic acid--AMP ligase FadD22 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD22 PE=1 SV=1 2597 2920 9.0E-06
sp|P9WQ60|FAA22_MYCTO p-hydroxybenzoic acid--AMP ligase FadD22 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD22 PE=3 SV=1 2597 2920 9.0E-06
sp|Q7TXK7|FAA22_MYCBO p-hydroxybenzoic acid--AMP ligase FadD22 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fadD22 PE=1 SV=1 2597 2920 9.0E-06
sp|A7Z809|MENE_BACMF 2-succinylbenzoate--CoA ligase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=menE PE=3 SV=1 4243 4605 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 54 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3418
METKSNWSYETNGNGNAGDYHEPMCVDLVIKQRARDQPGAVAVCAWDGQLSYAELDDLSTAMAIHLAKGGVKPEA
YVPIYSEKSVWVPVAALAVLKAGGAFVLLDISYPASRLETICHTVGATIVVASEKTTDKAKKLAAKVVVTGIYDN
VDDGSIQRAKPSNAAYAIFTSGTSGKPKGVTIEHQAFCSSAFEHAKALDMNASSRVLQFASYAFDACLTEMLAAL
MVGACVCIPSEQDRVFRVRDHVRQLHVTWALLTPSVSRVLDVSDLAGVRTLVLGGEAVQVDDITKWTPHLDLFIA
YGLTECAVVNMVHPCRQGDVDAANLGHGVGVDCWVAQQDNHGRLVQAGHVGELLLSGPSIGRGYIDDPVRTADAF
ITKTPWYSGSSRIYKTGDLVICDPIDGTIRYVGRKDTQAKLYGQRFEAAEIEHHIRRQLPASQHIVVQVAQIDES
ETLVALVSPAAANSPAQDDWLLDPTDEFRHQARMTQRALRNVIPSWMVPSVFLPLGRMPLTASGKCDRRQLSCWI
ASLSRTQLQTYALSRPTGAKHKAESPTEKVVRELWAQILQIEAGNIVRQDSFFDLGGSSIDALKLASAARKQGLD
LALDCLYGNDSLAAMAASVQPASQSTIQPFSLVEEREPVTERVTELCQLMDTSDLEDVYPCTPLQEELLSLTAKR
PGAYRVAFEYDLPDDVDASRFKRAWDAVVEANPILRTRFVQTSTGAMYQAVIHGSLPWSSRHEALSTWDGGALGR
PLIRFCLEPVDGRYQFTLVLHHALSDGWALQLILRQAQEAYDGATLTPRPFAAFIEYVGKSQTEECESFWKGQFA
DLEAATFPSLSSAAYIPNLIRKETVTMPVESATYRQFAIPNRLTLAWGILITLYTDSLDAVFGVTVTGRGAPVLG
VDEMTGPTIATVPCRLRLSPDMTIEDGLSQVQRNRFAATPFEQAGLQRISRMSADANSACRFQSLLVIQPRQDGR
PPLFQSVRDLAAVDAFSSYAITLICWQMGDSVQVEATFDAGVVDETQMRRMLHQLRHIFLQLRPSERQLRIKDVD
VTSAEDWAELAKWNQTVCEPVRACAHDLVSEQVQRQPDAPAVCAWDGDFTYRQMEDLSSRLAAHLVAEGVEAGVF
VPLCFEKSRWVAVAMLAVLKAGGAFVLLDPSYPTERLRTMCRDCSATLIVTSSQQATLARSLTSRAIIVATHGEQ
RWKEEPATPSRLPALFILIFRGFAAYAFDISIADHLLTLVAGGCICIPSQQDIEGRISEAITRLGANWACLTPSV
ARVIDPANTPSLRRLVLCGEPLPGHIVSLWSPYAHLLNLYGPAECAILTTLHRDVRDATDPNNIAFPTSAVCWVV
DAQNAYRLAPLGTVGELLVESPIVGHGYLNDGERTAESFIAPDQRPRWLRRFRAGQNSRLYLTGDLVQYTKDGSL
RYIGRKDTQIKLRGQRVELGEVEHHLRRCFPGAQDAIAEIVVRRPGNQAAALTAFILPEQTIFKIPDKLFLARAA
ETRGRLELAVPPYMVPAVFIPVNQFPYSTSGKLDRKLLRSLAADLSLDEYSKSQQSQSQELSSSEVSAPQTQAYS
SNDETVKRAPSTDVEQTIHAIWARVLDIDSESFGVEDNFFRLGGDSIGAMRVVAQCATAGLRSSVAALFKAKTIA
QMSLTIEKIHSTISIPAERLEKRFSLSPIQQLFFDNADGDLNHFNQSLSFRVPHSVSSQAIQEAIEWIVAHHSML
RARFVQEANGHWEQYISRDAASSLLYEDDRARTRQEAASLIEADQRKLDILRGPLLVAHVLSIIDVDELHLSLTV
HHLVMDNVSWKILLADLEHLLASQGPPALPPLSFQAWCQLQAAYTKKHTETIEVLPRNALTLNVHEYWRVDTDDN
CWGNTLEQGFNLGEQETQTLVGDAANKAFGTQPVEILHAALLQAFLQTFKDRPSPIIFSEGHGREPWDASIDPTG
TIGWFTTIWPAHIPVEPTDTVLEIVRKTKDARRQIKSNGWAYFTSRQLVGPKPDGPIEILFNYHPGFTGGSKGLL
QPSSLVDGQLFQMSPSMPRFALINVMAEVADSRLSLSFIFNKRMQSSMSKWITQTQSCLEAAASLLVDRAAALTL
SDFPLLSYSYPELDAFSTNILAAMGASADNIEYVYPCSPIQEGMLLSQAKVSSHYLNRAFWVLRSRGNGPVREEQ
LRTAWLRVVQKHPLLRTVIFRSPRDDGHHDQLVLREPPDGMCVVLPACEDPLQRLKDHQFDTPELSPPHRFAICS
SHHGDVMCLLEISHALVDGFSRQLLLRDLCSAYDGPLVRNHAVGTYRDYVEYLESIPREDAIIFWQSYLKSVQPC
NLPPTPPRQPFNDTKRVHNFKLSSDHALHHFCAQQELTLGNVLQLAWALVLRLYVGAESVCFGYMSAGRDVPVPG
VDEIVGPLINILIFRLPIDGGESLLDLLRQNQADFVQCLKYQHLLTADKMKAAEKSDSKLFNTIMSVQREIEPRR
DDSSVEFGELGGEDPTEYDVILNIGLLEQEVNVSLQYRLAFISDEQIENMADAFQQALLDIVAEPSQTARTMSLF
GALSYQRVTEYNRHELVPVNDFIDELIASRCRAQPLALAIDACDGKITYGELDDYSSLVAAELAQRDIGPNRFVA
LCFEKSLWTTVALLGVLKAGAAFILLDPSHPQERLQSICRDAIVAIVLTSNSNRSLAAQLASETLDVGKQIVSWK
MKATPPNRGSRDPSDVAYLIFTSGSTGKPKGVMVQHDGLATSALSHGSAFLMNTSSRVLQFASYAFDASIVDQIT
TLIFGGCICIPSDVQRQDIAKSAAAYEANWVSLTPSVARALDPADFQTLQTLVCGGESFNDKVMSAWFPHVNFFT
AYGPSECAIICSGNLITSEFDDLRNLGRFFASHAWVVSPDDPSILLPVGAVGELVVQGHIVGRGYLQDPDKTAYA
FIEPPMWLSKFRNGSGGRLYRTGDMVRYVNGEVQFVGRKDSQVKLRGHRIELGEVEIHVLASFAGAVHALVEVVT
PVDGGKALLVAFIQTTNESPETNHDSLFDKPSKPFALKAQSAETQMTKSLPIYMIPVLFLPLRWMPLTGTGKADR
NRLRSAAARLSAQELEQYAFSTRPNVMPSTKDEALLQKVWARVLNKDLASVGIHHNFFRLGGDSISAMQVTSRCA
AAGLRVTVADIFRHKTIAQLAAGMEKSSALDLPSEKVDCPFELSPIQKLVFRVAPLGKHHFNMGFFLRIAHMIPS
DHLDDALHQLVQQHSMLRARFSQSQDGHWVQSISADAPGSYRFRACDIDTMDQAGEIISESELAVDIQHGPILAV
DLINVGSQNQFLFIVAHHLVTDLVSWRILLADLEDYLTRGSISKPSLPFQTWCHLQAEYAARHLDPEHARLDNGA
APPPADYWGIARQSNSVKDTAQTAFTIDQATTIGLFGAANEAFRTRPVELFQAALLFSFAQVFRDRSAPVLWNEG
HGREPWTRQLDLSRTVGWFTTLWPVAVEADGLSLFDVVRRTKDKCRSSPDNGWAHFTSSLHHNARHIDVREITFN
FIGRFQQLEREESLFMAHPRPPSRISDISEELGRLSVIDVTADVRDDCLGFQFHYNKYAADNRPILDWIIECKRT
LVRMAGELPERPAEHTLKDFPLLPFTYDSLDSFLVHTLPSYGVSPANVEDAYPCSPIQRGILLSYAKQARHYQTF
LVFKVKPQNGSEAVSLDRVVASWQRIVSRHAIFRTVFVESISQDNWLDQVVLKKVSAHVNILSPDEEARMMTALS
DDRQLAVTRGQLPYRMTMGQTVTGDVLCGLEMSHSLFDGASRQNLLAELALAYDGPLSCVPGPAYRDYIAYLESR
PVKSHQQYWAKYLEGVVPCQIPATPDIRINSAEDTLGSIHIHLGDMSALRQFCQSNELTLSNVFQVVWGVVLRAY
TNSDDVCFGYLSSGRDVPVPQAHEMIGPLINMLVCRMQIDDSQSLRETLEAGQDSFAESLKHQHYPLAEMLRAAN
ISGGRSLFNTVMSLQTMGRTKSNDTSSVRVDVVGGEDASEYNMTIHVLVEVDGIDILLEYWRSSLSDDQANQVAE
TLRQVVLQVVDKADNSIGDIELVSKTSLDTLTQWSGTLPPPEYTLVHDLIHEQCLAQPEAPAVDAWDGTFTYREV
DELSSKLANHLAHFRLAPDSFIPICFEKSRWTTVAMMAVMKTGCAFIPLDPSQPVQRLQDICQGAQVSALVASKE
QARIAACLAKHVVTVGDDDQDWRETDPGHQLESFSPRNLLYAIFTSGSTGKPKGVMIEHCAFSSSAKAHSKALNI
TKDSRVLQFASYAFDASVSETLTTLLKGGCVCVPSDEERKISLAAVVSRTQANWMFMTPAVARVLNPDDFPSIKT
MLCGGEVVSETELMLWRDAVDLRLVYGPTECAVYCSATNQVTAETSARNLGRPFGCRSWVVKPHNHQKPVPIGAV
GELLIEGPIVSRGYLDDSERTASVFIDQPEFLKTLGDTPSAIYKTGDLVKYNADGSLEYVSRKDTQVKLRGQRIE
LGEVEQRARQCFPRSTDVVVELVESMGPSRHPALVALIHTAAELPTKGQDILAEPSSSFRQEAQAAETALTEMLP
SYMVPSFYLPVHRMPLSNNGKVDRRLLRQLASTLSDGQVTAYSTSLGGSKLQPTSDVERRLRAVWARILNLEPEA
IGIDDSFFRIGGDSISAMQVVTQCANERLQLTMADFFRYKTISAISQQTTCSVAPTQDIEVQYESPFDLSPIQQM
FFETAPDGVKYFNQSFFLRLNTDIDSAVLRDAMTQLVTRHHMLRARFRKTVNDTSRIGGCMWQQLISDTVDGAFR
YQEHQVAHLEESRLILVTAQTLLDMQHGPVFSADLVNVASGGQYLFMVAHHLVVDLVSWRIIIRDLEDLLKTRSI
VSPPSISFQAWCRLQSDYALEHLTPDCPLAVQVPAPMLDYWGLSTGNNLVSDIVEKELVLGEQVTRTLLGTANDA
FQSRPVELLQAALIHSFALTFQDRPLPAIFSEGHGREAWDSSINLNSTVGWFTTLSPTVIESTDLLEAVRQTKDQ
RRRLRDNGWAYFTSRYLGSADRLSLKTPLEIVFNFTGSYQQLERSDALFSLATEFRPSVPDISQDSPRFALFDVS
ATVSNNRLRLSFFYNHRAADVRPVDLWISNYAKTLERLSSTLPSQPLTYTLADFPLLRCSYAALDRFVEETIPRC
QLSMDQVEDVYPCSPIQNGMLLSQTRSTAVYYNRFLFRVKPNSGTGNVCEKRFARAWRRVVARHPILRTFFIPSL
GQGSFMDQVVLQEARDDIVTMLPIAKDPLTILQNHSSGLQAQGVVPHHLTTCCSPNSELLVLLEIDHSLLDGTSL
QILVRDLQSAYDDSLPAQAAMPYKDYIAYVQSIPTEEAKQYWMRYLEGSNPCLFPSMSTNSEYPKWQSAVAQLGA
SSDLTRFCEANHLTLSNVVQVAWGLVLRAFTGSDDVCFGYLTSGRDIPLPGVEEALGPLINMLVCRIDFSNGSTM
ADLLQRAQEDHVQNSRHQHLSLAEIKGSLQLPDIPLFNTIVSLQRSGMVRAVESKRSVAIEPVQGKDPTEYDMTV
NVWVHEDSIKLVLNYWTSFTTAGQAATVLDTLSQAISEIRLKVSQRAADMNLLGPRSRQQVWQWNQRVPARIDRC
AHDLIRERNLERAEEPAVCAWNGDFSHGELDQKASQVAAHLVREHGVEPGVFVPVYFEKSRWTIVAILAILKSGG
AFVLMDPSHPAQRLSEICRDVGAAIVVTSESKATDAAELGPQVIVIGDGEFAWKEAEPLNELRARPSDPIYAVFT
SGSTGKPKGAIMTHAAWCTSAEANRIGLFVESRSRVLQFASYAFDISIADMLLTLLAGGCVCVPSDEDRQSDLMG
AINNLEANWACLTPSITRIIEPGMVPSVHTLVLCGEAVAPGDIAKWKPHVHLLNLYGPAECAILTTLNRFVHDEK
DANNVGYPTSAVCWVVDPDDYEKLVPVGQVGELVVEGPIVGREYIGNPSQSAASFLPCPLWLRQFRPSAAGPIYR
TGDLVQYVEDGSLRSIGRKDTQVKVRGQRVELGEVEHHLRQSFPDAQYTVAEVIQTGGRPSLAAFIYTGGPEADE
SDDDNIFRAPDDHFNMAASKAVSHLQRVLPVFMVPTSFIALARAPLTKTGKMDRRTLRAAAANLTRERFAQTNLI
RKRAPRTQREGQLRSLCADVLGLPPSDVGIDDHFFRLGGDSILGMALIHKAREAGLAITMADIFTNPKVCDLAAA
STQATPSISSSISPFALVDDADTMVQLASAQCGISATQIDDIYPCTPLQEGLVALSAKRPGHYIATFEFTLAESV
DVKRFIAAWDSVVVANPILRTRVIQSDSGFLQAVVKDAVPWQSFDGPESCRKHVNATSMGLGDPLVQFALVESRA
FHLTLHHALYDGASLPKLWSQAEAAYKGVSLPPRPFNSFIGHVLAARGGDFWRSEFAGFNGPVFPTLPRSRYIPD
PAAALEHRIAELELESIEYTISTAIRLAWAVVLSCHADSDDILYGLTVNGRSAPLEGIEDITGPTFATFPVRTRV
NQSDTVQTALAAIHQQTTAAMPFQQFGMQNMRQLSPEAAAACSFQCHVTIQPSGEYPRHGLLADVRTKHEDYGKF
ANYAFVPICHLPAKDESELLVTVSHDANIVHPLQARRMVQQFEHVLRQLVRQRCQSLCLGQLDLISPQDRQQLLE
WNRALEKRGEREGGRGQCLHEMVLSYASSLPKAPAISAWDGDMTFSQLDAATATLARQFQSLGIQAGDFVALLFD
RCRWLVITMIALHRIGAVCVNIDPTLPREHIQQLLNLSRASFVLTGPQDLAEMGFDNTTVATVPIVGAQPQPHEF
SAPNVDCHDAAFVTFAWGSKGEPAGTITEHANLATWIRDNSHEARLNPGTRGLHFAPYASEASIYEIFAVLANGG
CICIPSESDDIVSFINKHGINWALFTPSFLSRMSPNAIPGVGTILVSGEATATQNIDGWASHVNLVATRCGPTKT
TLAPSVEKQGSLVRVTAGVGWIVVPSEPSRLVPIGAPGELVVEGQSRDSENTNPPWLGPFREGNTSSSRLYRTGH
LVQYSSDGALLFLGRRDAQIKLRGQRIELGEVEHQVRRAFPGILDVVAEIISPHDGGGSAFLVAFVASGVDSMSE
SLFETCNAEFLAQAEAASRSMGKVVPDHMVPAIFVRLSAMPRDKHGKADRGRLLMEASKLSQHQLQALFRHVDVD
IKRRKPETAQEILLQTLWAQVLTMAPDDIGLDDDFFNLRGDSISAMKLAGLARRHGKLLPVSRIFKFPVLSEQAA
MMETSNVHDPEDEYRPGSLLGITDVSAFFDDQLGAQARAYRGQDVEDVLPTTETQASFLRNKNLTHTRLHLSTEI
DADRLDAACRALVRKHAILRTVFVVHDDGILQVVLRDVQVPLLRLECSEDLWQYSEKLYEQDASSPVPFGSLHFQ
PILVSRSESEHMLILRMTHAQYDGGSMPMLSQDLALAYDGHELAERPPFAHFLRYRQRQDTTQTREFWRAHLLGS
EMTDYRVLCKAPPAVSKEHESVVKPLRETALPSPPPGVTMASLVKAAWSVVLARAAGKTDIVFGHLINGRDALLQ
GIHDISGPCITMSPFRVVLEESWTWMDLLGHVQAQYLESMPFSHSDLAKIRRHCTAWPADTHFGSVVTHQDANID
LTGSINGSPPSIWRNLNLGIHYDFHVVTTPVEDRLLVQFSVSSAKINQDDADTTIDEFCRIMAEISADPTRPIQL
Coding >Ophio5|3418
ATGGAAACCAAATCGAACTGGTCGTACGAGACCAATGGAAACGGAAATGCAGGAGACTACCATGAGCCCATGTGC
GTCGACCTGGTCATTAAGCAACGGGCTCGGGACCAGCCAGGGGCAGTGGCTGTGTGTGCCTGGGACGGACAGCTG
AGCTACGCCGAGCTCGACGACCTGTCGACAGCCATGGCAATCCATTTGGCCAAAGGCGGAGTCAAGCCCGAGGCA
TATGTGCCCATTTACTCGGAAAAGTCGGTCTGGGTGCCGGTGGCGGCGTTGGCCGTGCTCAAGGCGGGCGGTGCC
TTTGTTCTGCTCGACATCTCGTACCCGGCAAGCCGACTCGAGACGATATGCCATACGGTTGGCGCCACCATTGTC
GTGGCATCCGAGAAAACGACGGACAAGGCGAAGAAACTGGCGGCCAAGGTCGTCGTGACGGGCATTTATGACAAT
GTCGACGACGGCTCGATTCAACGGGCCAAGCCCAGCAATGCCGCCTACGCCATCTTCACCTCGGGCACGTCCGGC
AAGCCCAAGGGCGTCACCATTGAGCATCAAGCCTTTTGCAGCAGCGCCTTTGAGCATGCCAAGGCCCTCGACATG
AATGCCTCTTCACGCGTGCTTCAATTTGCTTCGTATGCCTTTGACGCCTGTCTCACGGAAATGCTCGCAGCCCTG
ATGGTAGGCGCATGTGTGTGCATTCCATCCGAGCAAGACCGCGTGTTCCGTGTTCGGGACCATGTTCGCCAGCTC
CACGTCACCTGGGCTCTCCTGACGCCGTCTGTGAGCCGCGTCCTCGACGTAAGCGACCTGGCAGGTGTTAGGACT
CTCGTGCTGGGGGGGGAGGCGGTTCAGGTCGACGATATTACCAAGTGGACGCCTCACCTGGACCTATTCATCGCC
TACGGACTGACCGAATGTGCCGTTGTCAACATGGTCCACCCATGCCGCCAGGGAGACGTCGACGCTGCCAACTTG
GGCCACGGCGTTGGTGTTGATTGCTGGGTCGCTCAGCAGGACAACCATGGCCGTCTGGTCCAAGCAGGTCATGTA
GGAGAGCTTCTCCTCAGCGGGCCCTCAATCGGTCGCGGATACATCGACGACCCCGTCCGGACCGCTGACGCCTTC
ATCACAAAGACTCCCTGGTACTCAGGCTCATCCAGAATTTACAAGACAGGAGACCTCGTGATTTGTGACCCCATC
GACGGCACAATCCGCTATGTCGGACGTAAGGACACACAAGCCAAACTCTACGGTCAGCGATTCGAGGCAGCCGAG
ATCGAGCACCATATCCGGCGTCAGCTCCCTGCCTCGCAGCACATCGTAGTCCAAGTTGCACAGATCGACGAATCC
GAGACGCTTGTCGCCCTTGTCTCGCCGGCGGCGGCAAACTCTCCGGCGCAGGATGACTGGCTGCTGGATCCCACA
GACGAGTTTCGACATCAAGCGCGAATGACCCAACGAGCACTGCGCAACGTCATTCCCAGCTGGATGGTTCCAAGC
GTATTCCTACCCTTGGGTAGGATGCCGCTCACCGCGAGCGGCAAGTGTGACAGGAGGCAGCTGAGTTGCTGGATT
GCAAGCTTGTCCCGGACCCAGCTCCAGACATATGCTCTGTCGCGACCGACGGGTGCCAAGCATAAGGCCGAGAGC
CCGACGGAGAAGGTTGTCCGAGAACTCTGGGCCCAAATTTTGCAGATTGAAGCCGGCAACATTGTCAGGCAGGAT
AGCTTCTTCGACCTCGGCGGGAGCTCCATTGACGCACTGAAGCTTGCCAGTGCAGCCCGCAAGCAGGGCCTTGAC
CTCGCCTTGGACTGCCTGTATGGCAACGACAGTCTTGCCGCCATGGCAGCTTCTGTCCAGCCAGCTTCACAATCG
ACAATCCAACCATTCTCTCTCGTTGAAGAGCGAGAACCCGTCACAGAACGTGTGACGGAACTATGCCAGCTCATG
GACACATCTGATCTCGAGGACGTGTATCCTTGCACTCCTCTCCAGGAAGAACTCTTGTCGCTCACGGCCAAGCGG
CCTGGGGCGTACAGGGTTGCTTTTGAGTACGACCTCCCAGACGACGTTGACGCGAGTAGGTTCAAGAGGGCTTGG
GATGCCGTTGTCGAGGCCAATCCCATATTGAGAACCCGCTTCGTTCAGACAAGCACTGGGGCCATGTATCAGGCC
GTTATTCACGGATCGCTTCCTTGGTCGTCCCGGCATGAAGCTCTCTCGACATGGGATGGAGGAGCACTCGGACGA
CCGCTTATTCGTTTTTGCCTTGAGCCCGTAGACGGGAGGTATCAGTTCACCTTGGTCCTGCACCACGCCCTCAGC
GACGGATGGGCGTTGCAATTGATATTGCGCCAGGCACAAGAGGCATATGATGGAGCGACGCTTACGCCACGACCA
TTTGCCGCCTTCATCGAGTATGTAGGCAAGAGTCAGACCGAAGAGTGCGAGTCCTTCTGGAAAGGCCAGTTTGCC
GATCTTGAGGCGGCGACATTCCCTTCACTGTCATCGGCTGCGTATATACCCAACCTGATACGAAAGGAAACGGTC
ACGATGCCGGTCGAGTCTGCAACTTACCGCCAATTCGCCATCCCCAATAGGCTGACACTTGCCTGGGGCATTCTT
ATAACCCTCTACACAGACAGCCTGGACGCCGTGTTTGGCGTCACAGTGACCGGGCGCGGAGCACCCGTGCTGGGG
GTCGACGAAATGACGGGCCCAACAATTGCGACAGTCCCGTGCCGACTGCGGCTGAGTCCCGACATGACGATAGAA
GACGGGCTCTCGCAGGTGCAGAGAAACCGCTTTGCGGCGACTCCTTTTGAGCAGGCCGGGCTTCAGCGCATTAGC
CGCATGAGCGCCGATGCCAACTCGGCCTGCCGGTTTCAAAGCTTGCTCGTGATTCAGCCCAGGCAAGACGGACGC
CCGCCTCTGTTCCAAAGTGTCCGGGACCTAGCGGCCGTCGACGCCTTTAGCAGCTATGCCATCACCCTCATCTGC
TGGCAAATGGGCGACTCGGTCCAGGTAGAGGCGACGTTTGACGCGGGCGTTGTCGACGAGACGCAGATGCGAAGG
ATGCTGCACCAGCTGCGGCACATCTTCCTGCAACTCCGGCCGTCTGAAAGGCAGCTGCGCATCAAAGATGTGGAC
GTGACCAGCGCCGAGGATTGGGCCGAGCTGGCCAAGTGGAATCAGACTGTGTGCGAGCCTGTCCGCGCCTGCGCT
CATGATCTGGTCAGCGAGCAGGTCCAGCGTCAGCCCGACGCGCCGGCGGTGTGCGCCTGGGACGGCGACTTCACC
TATCGCCAGATGGAAGACTTGTCATCGCGCCTCGCTGCCCATCTCGTGGCCGAGGGCGTCGAAGCCGGCGTCTTC
GTGCCCCTCTGCTTCGAGAAGTCGCGCTGGGTGGCCGTGGCTATGTTGGCCGTCCTCAAAGCTGGGGGGGCCTTT
GTGCTGCTTGATCCGTCTTATCCGACCGAGCGATTGCGGACCATGTGCAGAGACTGCAGCGCCACCTTGATCGTG
ACGTCGAGCCAGCAGGCTACTCTGGCGCGGAGCCTCACGTCACGTGCCATCATCGTGGCTACCCATGGCGAGCAG
CGCTGGAAGGAGGAGCCGGCGACACCGTCTCGCCTACCGGCGCTGTTCATTCTCATATTTCGTGGTTTCGCCGCC
TACGCCTTCGATATTAGCATCGCCGACCATCTACTGACGCTCGTCGCCGGCGGATGCATCTGCATTCCGTCGCAG
CAAGACATCGAAGGCCGTATCAGCGAGGCCATCACCCGCCTAGGGGCTAATTGGGCCTGCCTTACCCCTTCTGTT
GCCCGCGTTATTGACCCGGCCAACACGCCCTCCCTGAGAAGACTCGTTTTATGCGGCGAGCCGCTTCCCGGTCAC
ATCGTCTCTTTATGGTCGCCTTACGCACATCTCCTGAATCTCTATGGCCCGGCCGAATGTGCCATCCTTACGACT
CTTCATCGCGACGTCCGTGACGCTACGGACCCAAACAACATTGCCTTTCCCACCAGCGCCGTCTGCTGGGTGGTA
GATGCCCAGAACGCGTATAGACTAGCCCCTCTAGGCACCGTTGGCGAGCTCCTTGTCGAGAGCCCTATCGTCGGA
CATGGCTATCTCAACGATGGGGAGCGGACGGCAGAGTCCTTCATCGCCCCCGACCAACGCCCGCGTTGGCTTAGG
CGTTTTCGGGCAGGGCAAAACTCGCGCCTGTACCTCACGGGGGATCTTGTCCAGTATACCAAAGACGGCTCGTTA
CGCTACATCGGTCGCAAGGACACTCAAATCAAGCTGCGCGGACAACGGGTTGAGCTGGGTGAGGTCGAGCATCAC
CTGCGCCGCTGCTTTCCCGGTGCCCAAGACGCCATCGCCGAGATTGTGGTGCGACGCCCAGGCAATCAGGCGGCC
GCCTTGACGGCCTTTATCTTGCCGGAGCAGACCATTTTCAAAATCCCAGACAAGCTTTTCCTCGCCCGCGCGGCA
GAGACACGGGGCCGCCTCGAGCTTGCAGTCCCGCCGTACATGGTGCCGGCTGTCTTTATCCCTGTCAACCAGTTT
CCCTATTCCACGTCGGGCAAACTGGACCGAAAACTGCTTCGCAGCCTGGCAGCTGACCTCTCTCTAGATGAGTAT
AGCAAGTCTCAGCAAAGCCAAAGTCAGGAGCTGTCTTCTAGCGAGGTCTCCGCCCCTCAGACACAGGCATATTCG
TCAAATGACGAGACCGTCAAGCGAGCGCCCTCGACTGATGTCGAGCAAACCATCCATGCAATCTGGGCACGCGTG
TTAGACATTGACAGCGAGTCTTTTGGTGTTGAAGATAACTTTTTCCGCCTCGGCGGAGATTCCATCGGCGCCATG
CGTGTCGTCGCTCAATGTGCTACTGCCGGGCTTCGAAGCTCCGTTGCGGCCCTCTTCAAGGCCAAGACGATTGCT
CAAATGAGCCTCACCATCGAGAAGATACACTCGACAATTTCAATACCTGCCGAGCGACTGGAAAAACGCTTTAGC
TTGTCACCAATCCAGCAACTGTTCTTCGACAATGCTGACGGCGACTTGAACCACTTCAACCAGTCCCTGTCATTT
CGCGTTCCTCACTCCGTGTCATCGCAGGCCATCCAGGAGGCTATTGAGTGGATTGTCGCGCACCATTCGATGCTT
CGTGCCCGATTCGTGCAGGAGGCCAATGGCCACTGGGAGCAATACATCAGCCGAGATGCTGCCAGCAGCCTTCTG
TATGAGGACGATCGGGCCAGGACGCGCCAAGAAGCGGCTTCTCTGATCGAAGCCGACCAGCGCAAACTGGATATT
CTAAGAGGGCCTTTGCTTGTCGCTCATGTCCTTTCCATTATCGACGTCGACGAGCTTCATCTCTCCCTGACTGTT
CACCACCTCGTTATGGACAATGTCTCTTGGAAAATCCTCCTTGCGGACCTTGAGCACCTGCTCGCAAGCCAAGGA
CCGCCCGCCCTGCCTCCACTTTCCTTCCAGGCCTGGTGTCAGCTGCAAGCCGCGTATACGAAGAAACACACTGAA
ACGATCGAGGTGCTGCCGCGGAATGCACTCACATTGAACGTACACGAATACTGGAGAGTTGACACCGACGACAAC
TGCTGGGGAAATACACTCGAGCAGGGCTTCAACCTTGGCGAGCAGGAAACCCAGACCCTTGTAGGTGATGCCGCG
AACAAGGCCTTTGGCACCCAGCCCGTCGAGATCTTGCACGCGGCCCTGCTCCAGGCATTTTTGCAGACATTTAAG
GACCGACCGAGCCCCATCATCTTCAGCGAAGGTCACGGTCGCGAGCCGTGGGACGCCAGCATCGACCCGACAGGG
ACCATCGGCTGGTTCACGACAATCTGGCCCGCCCATATTCCCGTCGAGCCGACCGACACGGTGCTTGAAATCGTG
CGCAAGACTAAGGACGCGCGCCGACAAATCAAGAGCAATGGATGGGCCTATTTCACGTCTCGCCAACTCGTCGGA
CCGAAGCCTGACGGCCCCATCGAGATTCTCTTCAACTATCATCCGGGCTTCACTGGGGGCTCCAAGGGGCTCTTG
CAGCCGTCTTCCTTGGTCGATGGACAATTGTTCCAGATGTCGCCTTCCATGCCACGGTTTGCCCTCATCAACGTC
ATGGCTGAAGTTGCCGACTCTCGGTTGTCGTTGAGCTTCATCTTCAATAAGCGAATGCAGTCATCCATGTCCAAG
TGGATTACACAAACCCAGTCGTGTCTCGAGGCCGCGGCATCCCTTTTGGTGGACAGAGCTGCTGCCCTCACCTTG
TCCGATTTCCCGCTCCTGTCATATTCGTATCCCGAGCTTGACGCCTTTAGCACCAACATTTTGGCCGCGATGGGT
GCCTCTGCAGACAACATCGAATACGTGTATCCTTGCTCACCGATACAAGAGGGCATGCTACTCAGCCAGGCCAAG
GTTTCGTCGCACTATCTCAACAGGGCGTTCTGGGTGCTAAGATCGCGAGGAAATGGCCCCGTGCGCGAAGAACAG
CTCAGGACCGCTTGGCTGCGCGTAGTGCAGAAGCACCCTCTCCTTCGCACCGTTATTTTCCGGAGTCCTCGTGAC
GACGGCCATCATGACCAGCTGGTGCTCAGGGAACCTCCGGACGGAATGTGTGTCGTGCTGCCCGCCTGCGAGGAT
CCGTTGCAGCGGCTCAAGGATCATCAATTCGACACACCCGAACTGAGTCCGCCTCACCGGTTTGCCATTTGCTCG
TCACACCATGGCGATGTGATGTGCCTGCTCGAGATCAGCCACGCATTAGTCGACGGCTTCTCCAGACAGCTGCTC
CTGCGTGATCTGTGCTCCGCATACGATGGCCCGCTCGTCAGAAATCATGCAGTGGGGACATATCGAGACTACGTT
GAATATCTTGAGTCTATCCCCCGGGAAGACGCCATCATCTTTTGGCAGAGCTACCTCAAGTCGGTGCAGCCATGC
AATCTTCCGCCTACGCCACCTCGTCAACCCTTTAACGACACCAAGCGGGTACACAACTTCAAACTATCCTCTGAC
CATGCGCTCCATCACTTTTGTGCTCAACAAGAGCTCACACTGGGCAACGTGCTGCAGCTGGCGTGGGCCTTGGTC
CTTCGGTTATATGTTGGTGCTGAATCCGTGTGCTTCGGGTACATGTCTGCAGGCAGAGATGTCCCCGTGCCCGGC
GTCGACGAAATCGTCGGCCCGCTTATCAACATCCTGATTTTCCGTCTTCCCATTGACGGCGGGGAGTCTCTACTC
GACTTGCTACGACAGAATCAGGCGGACTTTGTTCAGTGCTTGAAATACCAGCATCTTCTCACGGCGGATAAGATG
AAGGCAGCCGAAAAGTCGGATTCCAAGCTCTTCAACACCATCATGTCTGTCCAGAGAGAGATCGAGCCACGCCGA
GATGATTCGAGCGTGGAATTCGGGGAACTGGGTGGGGAGGACCCGACCGAGTACGATGTCATCCTCAATATCGGT
CTCCTGGAACAGGAAGTGAACGTGTCGCTTCAGTACCGCTTGGCTTTCATCTCCGACGAGCAGATCGAGAACATG
GCAGATGCGTTCCAGCAAGCCTTGCTTGACATCGTGGCAGAGCCGTCACAGACAGCCAGAACCATGAGTCTCTTT
GGCGCGCTAAGCTATCAACGCGTGACAGAGTACAACAGGCATGAGTTAGTACCTGTGAATGACTTTATCGACGAG
CTCATCGCGAGTCGCTGCCGCGCCCAACCTTTAGCCCTTGCGATTGACGCCTGCGACGGGAAGATAACGTATGGT
GAACTCGACGACTATTCCTCGCTTGTCGCTGCCGAATTGGCTCAACGTGACATCGGCCCAAACCGATTCGTTGCT
CTATGCTTCGAAAAGTCTCTTTGGACCACTGTGGCTCTACTGGGCGTGCTCAAAGCCGGCGCGGCTTTCATTCTT
CTGGATCCCTCTCACCCTCAGGAAAGGCTTCAGAGCATCTGCCGGGACGCCATCGTTGCAATAGTCTTGACATCG
AACAGCAACCGCAGCCTGGCCGCTCAGCTGGCATCTGAGACTCTGGACGTTGGAAAGCAGATTGTAAGCTGGAAG
ATGAAGGCCACGCCTCCAAATCGCGGCAGCCGGGACCCTAGCGATGTGGCATATCTCATCTTCACCTCGGGCTCT
ACTGGGAAGCCCAAAGGGGTCATGGTTCAACACGATGGACTGGCTACGAGCGCCTTATCACACGGCTCTGCCTTC
TTGATGAATACGAGCTCGCGAGTGCTTCAATTCGCTTCCTATGCATTTGACGCATCCATCGTGGATCAGATTACG
ACGCTCATTTTCGGAGGCTGCATCTGCATTCCTTCGGACGTCCAGAGACAAGATATTGCCAAGTCAGCAGCCGCC
TATGAGGCGAACTGGGTTAGTTTGACGCCGTCAGTTGCTAGAGCACTTGATCCCGCCGACTTTCAGACTCTTCAG
ACCCTCGTCTGCGGCGGTGAGTCTTTCAATGACAAGGTGATGAGCGCGTGGTTCCCCCACGTAAACTTCTTCACA
GCCTACGGGCCTTCAGAGTGCGCCATCATCTGTTCTGGGAACCTAATTACCAGCGAGTTTGATGATCTCCGCAAC
CTTGGACGCTTCTTTGCCAGCCATGCTTGGGTTGTGAGTCCTGATGATCCCAGCATCCTGCTTCCAGTCGGCGCG
GTAGGAGAACTAGTCGTCCAAGGCCACATTGTCGGTCGCGGCTACCTTCAGGACCCGGATAAAACCGCATACGCG
TTCATTGAACCACCGATGTGGTTGTCCAAATTCCGCAACGGCTCCGGGGGCCGTCTCTATAGGACTGGCGACATG
GTGCGTTACGTCAACGGCGAGGTTCAGTTTGTGGGTCGCAAAGACTCGCAGGTCAAGCTTCGGGGTCATCGTATC
GAACTGGGTGAGGTCGAGATTCATGTTCTGGCTTCCTTTGCCGGCGCTGTCCATGCCCTAGTAGAAGTCGTCACG
CCAGTGGATGGGGGCAAAGCACTTCTCGTCGCCTTCATACAAACGACGAATGAGTCCCCAGAGACGAACCACGAC
AGCCTCTTCGATAAGCCAAGCAAGCCTTTTGCTCTGAAGGCGCAGTCAGCCGAAACTCAGATGACAAAGTCCCTG
CCCATCTATATGATCCCTGTTCTCTTTCTGCCTCTACGATGGATGCCCCTGACTGGAACAGGCAAGGCGGACCGC
AACAGGCTTCGCTCAGCGGCCGCACGTCTTAGTGCCCAAGAGCTGGAGCAGTATGCCTTTTCCACGAGGCCTAAT
GTGATGCCATCGACCAAGGACGAGGCTTTACTCCAAAAAGTATGGGCACGTGTCTTGAACAAGGACCTTGCGTCT
GTTGGAATTCATCACAACTTCTTCAGACTTGGCGGCGACTCCATCAGTGCGATGCAAGTCACGTCGCGGTGCGCC
GCCGCAGGTCTCCGCGTCACTGTAGCCGACATTTTCCGGCACAAGACGATTGCGCAACTCGCCGCCGGCATGGAA
AAGTCATCGGCTTTGGATCTGCCATCAGAAAAGGTAGATTGCCCGTTTGAACTGTCTCCAATCCAGAAGCTGGTA
TTCCGGGTCGCTCCTCTAGGAAAACACCATTTCAATATGGGGTTTTTCCTTCGAATAGCACACATGATTCCCTCC
GACCATCTTGATGATGCGCTTCATCAACTTGTCCAACAGCACTCCATGCTCCGCGCCCGATTCTCCCAATCGCAG
GACGGTCATTGGGTGCAATCCATCTCTGCAGACGCGCCTGGCAGTTATCGCTTTCGTGCCTGTGACATTGATACG
ATGGACCAGGCTGGAGAAATCATCTCCGAGAGCGAACTCGCCGTCGATATTCAGCACGGCCCCATACTAGCAGTC
GATTTGATCAATGTTGGTAGCCAAAACCAATTCCTCTTTATTGTCGCCCACCATCTCGTGACGGACCTGGTTTCT
TGGCGAATCTTATTAGCAGATCTCGAGGACTATCTCACCAGGGGTTCCATCTCCAAGCCATCTCTTCCATTTCAA
ACATGGTGCCATCTACAGGCAGAGTACGCAGCCAGACATCTCGACCCGGAGCATGCAAGGCTTGACAATGGAGCC
GCACCACCTCCGGCTGATTACTGGGGAATCGCTAGACAGTCGAACTCGGTCAAGGATACTGCCCAGACAGCTTTT
ACCATTGACCAAGCAACGACCATCGGCTTGTTCGGGGCTGCTAATGAGGCCTTCCGAACACGACCCGTCGAGCTC
TTCCAAGCGGCTCTCCTCTTTTCCTTCGCCCAAGTTTTTAGAGATCGCTCGGCTCCGGTTTTGTGGAATGAGGGA
CACGGACGTGAACCGTGGACACGGCAGCTCGACCTCAGTAGAACCGTTGGGTGGTTCACCACGCTGTGGCCGGTG
GCCGTCGAAGCCGACGGACTCAGTCTCTTTGATGTCGTTCGCAGGACAAAGGACAAGTGCCGCAGCAGCCCAGAC
AACGGATGGGCACACTTTACCTCTTCTCTGCACCACAACGCAAGGCACATCGACGTCCGAGAAATCACTTTCAAC
TTTATAGGGCGCTTCCAGCAACTTGAACGCGAAGAGTCACTTTTCATGGCTCACCCAAGGCCCCCGTCCCGCATA
TCGGATATTTCCGAAGAATTGGGTCGTCTTTCAGTGATTGATGTCACGGCAGACGTTAGAGACGACTGCCTTGGT
TTCCAGTTTCACTACAACAAGTACGCCGCTGACAATCGGCCCATTCTGGATTGGATTATCGAGTGCAAACGGACA
CTCGTCAGAATGGCCGGGGAGCTACCAGAGCGGCCGGCGGAACACACGCTCAAGGATTTTCCCTTGTTGCCCTTT
ACGTACGACAGTCTTGACAGCTTCTTGGTTCACACTCTACCCAGCTATGGCGTCTCGCCGGCCAATGTCGAGGAC
GCATACCCGTGCTCTCCGATTCAGCGTGGGATCCTTCTCAGTTACGCCAAGCAGGCGCGTCACTACCAGACCTTT
CTTGTCTTCAAGGTTAAGCCCCAGAATGGTTCCGAGGCCGTAAGCCTTGACCGCGTCGTTGCGTCTTGGCAGAGA
ATTGTGTCGCGCCATGCCATCTTCAGGACAGTCTTTGTCGAGAGCATCTCGCAGGACAACTGGCTTGATCAAGTC
GTACTCAAAAAGGTGTCGGCTCACGTCAACATACTAAGTCCTGATGAAGAAGCAAGGATGATGACAGCGCTCTCA
GATGATCGGCAGCTCGCTGTCACTCGAGGACAACTCCCGTATCGGATGACGATGGGCCAAACAGTGACAGGAGAC
GTCTTGTGTGGCCTTGAAATGAGCCATTCGCTCTTTGATGGCGCATCCAGGCAGAATCTGCTTGCCGAGCTCGCC
TTGGCTTACGATGGCCCTCTTTCCTGTGTCCCTGGGCCGGCTTACCGTGACTACATAGCTTACCTCGAAAGCCGA
CCGGTCAAGTCGCATCAGCAGTACTGGGCCAAGTATCTTGAAGGCGTCGTACCTTGCCAAATCCCAGCTACCCCG
GATATAAGGATCAACTCTGCAGAGGATACACTGGGGTCTATCCACATTCACCTCGGGGACATGTCGGCTCTCCGG
CAGTTCTGCCAGTCCAATGAGTTGACACTATCCAACGTCTTTCAAGTTGTCTGGGGTGTAGTTTTGAGGGCATAC
ACCAATTCGGATGACGTTTGCTTCGGATATCTCTCTTCCGGCCGTGACGTGCCGGTTCCACAGGCTCATGAGATG
ATAGGCCCCCTCATTAACATGCTGGTCTGCCGCATGCAGATTGACGACTCGCAATCCTTAAGGGAAACACTCGAG
GCGGGCCAGGACTCGTTCGCCGAGAGTCTCAAGCACCAGCACTATCCCTTGGCCGAGATGCTTCGGGCCGCCAAC
ATTTCAGGCGGCAGGTCTCTCTTTAACACGGTCATGTCTCTCCAAACCATGGGCCGTACCAAGTCCAACGATACG
TCGTCTGTGCGCGTCGATGTGGTTGGGGGTGAAGATGCCTCAGAGTACAACATGACCATCCACGTCCTGGTTGAA
GTCGATGGCATAGACATCTTGCTGGAATACTGGCGATCATCACTTTCGGACGACCAGGCCAACCAAGTAGCCGAG
ACGCTGCGTCAAGTTGTCCTTCAAGTGGTTGACAAGGCGGACAATTCCATTGGAGACATCGAGCTGGTGAGCAAG
ACGAGTCTCGACACCTTGACCCAATGGAGTGGGACATTGCCGCCACCAGAATATACCCTTGTCCATGATCTCATC
CATGAACAGTGCCTCGCCCAGCCAGAAGCACCTGCTGTAGATGCTTGGGACGGCACTTTTACGTATCGCGAGGTC
GACGAGCTAAGCTCGAAGCTGGCGAACCACCTGGCGCACTTCAGGCTCGCCCCCGACTCCTTTATCCCTATTTGC
TTCGAAAAGTCTCGGTGGACGACGGTTGCCATGATGGCAGTCATGAAGACAGGCTGCGCCTTTATTCCTCTCGAT
CCTTCACAGCCCGTACAGCGCCTGCAAGACATTTGCCAGGGTGCGCAGGTTTCTGCGCTTGTCGCCTCTAAGGAG
CAGGCTCGCATAGCAGCATGTCTCGCCAAGCATGTGGTAACCGTCGGTGATGATGACCAAGACTGGAGGGAGACT
GATCCGGGGCATCAACTCGAATCATTTTCACCCAGAAATCTCCTCTACGCCATCTTCACGTCTGGGTCCACTGGC
AAGCCCAAGGGGGTAATGATTGAGCACTGCGCCTTTTCTTCAAGTGCGAAAGCGCATAGTAAGGCGCTGAATATC
ACCAAGGACTCTCGGGTGCTGCAATTTGCATCCTATGCCTTTGACGCGAGCGTGAGCGAGACGCTGACTACGCTA
CTGAAGGGCGGGTGTGTCTGTGTCCCTTCCGATGAGGAACGGAAGATTTCCCTCGCTGCGGTCGTTTCCAGGACG
CAGGCCAACTGGATGTTCATGACTCCTGCCGTTGCCAGAGTCTTGAACCCTGATGACTTTCCGTCTATCAAGACG
ATGCTTTGCGGTGGGGAAGTTGTCTCCGAGACGGAGCTGATGCTCTGGAGGGATGCTGTCGATCTGCGCCTCGTC
TATGGGCCAACCGAATGCGCCGTCTATTGCAGTGCCACCAACCAGGTTACGGCCGAGACGAGTGCCAGAAACTTG
GGCAGGCCTTTCGGATGCCGGTCTTGGGTCGTCAAGCCGCACAACCATCAGAAACCGGTCCCCATCGGCGCTGTG
GGTGAGCTGCTCATCGAAGGTCCCATTGTCTCTCGGGGATATCTCGACGACTCTGAAAGGACAGCCAGCGTCTTC
ATCGACCAGCCCGAGTTTCTCAAAACCCTTGGAGACACGCCATCTGCCATTTACAAGACTGGAGATCTTGTGAAG
TACAATGCCGACGGATCTCTGGAGTACGTATCAAGAAAGGATACCCAAGTCAAGCTCCGTGGTCAGCGCATCGAA
CTAGGCGAAGTCGAGCAACGGGCGCGGCAGTGCTTCCCTCGTTCGACAGACGTGGTTGTCGAACTCGTCGAGTCC
ATGGGCCCCTCGCGTCACCCGGCCCTGGTTGCTCTCATTCATACAGCAGCCGAGTTGCCGACCAAGGGTCAGGAC
ATACTCGCTGAGCCGTCGTCTTCGTTTCGGCAGGAGGCACAAGCAGCCGAGACAGCACTCACCGAAATGCTGCCC
AGTTACATGGTCCCCTCGTTCTATCTCCCCGTACACCGTATGCCACTCAGCAACAACGGCAAGGTTGACCGCCGG
CTCCTTCGACAGCTTGCCTCGACCCTTTCCGATGGCCAAGTCACGGCCTACAGTACCTCTCTGGGCGGCTCCAAA
CTCCAGCCGACGAGCGATGTTGAGCGACGACTGCGGGCCGTCTGGGCGCGGATCTTGAACCTAGAACCCGAGGCA
ATCGGCATTGACGACAGCTTCTTCCGCATTGGAGGTGACTCCATCAGCGCTATGCAGGTGGTGACGCAGTGCGCC
AACGAGCGACTTCAGCTTACGATGGCCGACTTCTTCCGATACAAGACCATCTCGGCCATCAGCCAGCAAACGACG
TGCTCGGTCGCACCGACTCAAGATATAGAGGTCCAGTACGAAAGCCCCTTTGACCTCTCTCCGATTCAGCAAATG
TTCTTCGAGACAGCTCCCGACGGTGTCAAGTACTTCAACCAGAGCTTCTTCCTCCGCCTCAACACGGACATCGAC
TCAGCTGTCCTACGCGATGCCATGACTCAACTCGTGACTCGCCATCACATGTTACGTGCTCGATTCAGGAAGACA
GTCAACGACACATCGAGAATTGGCGGATGCATGTGGCAACAGCTCATCAGTGATACAGTTGATGGTGCTTTTAGG
TATCAAGAGCATCAGGTTGCCCACCTGGAAGAGTCTCGCCTCATTCTCGTGACGGCCCAAACATTGCTAGACATG
CAGCATGGTCCTGTCTTTTCCGCTGACCTCGTTAATGTTGCCTCGGGCGGACAGTATCTCTTCATGGTGGCCCAC
CATCTGGTCGTCGACCTGGTCTCGTGGAGGATTATCATCCGTGACCTCGAGGATCTGCTCAAGACGAGGTCTATT
GTCTCTCCGCCCTCGATTTCTTTCCAGGCCTGGTGTCGACTTCAATCCGATTACGCCCTCGAGCATCTCACCCCA
GACTGTCCGCTTGCCGTACAAGTGCCTGCACCGATGCTAGACTACTGGGGTCTGTCGACTGGAAACAATCTTGTC
AGCGACATCGTCGAAAAGGAGCTTGTCCTTGGTGAGCAGGTGACACGCACTCTGCTCGGCACGGCCAACGATGCC
TTTCAGTCCAGGCCGGTCGAACTATTGCAAGCTGCCTTGATACACTCCTTTGCTTTGACTTTCCAGGACCGTCCT
CTACCAGCCATCTTTTCAGAAGGCCATGGCCGCGAGGCATGGGATTCAAGCATCAACTTGAATAGCACGGTGGGC
TGGTTCACCACGCTGTCGCCCACCGTTATCGAATCAACAGATTTGCTCGAGGCCGTTCGTCAGACCAAGGATCAG
CGCCGAAGGCTTCGTGACAACGGATGGGCGTACTTTACGTCGCGCTACTTGGGTTCTGCAGACCGGCTTTCCCTC
AAGACGCCTCTTGAAATCGTCTTCAACTTTACTGGCTCGTATCAGCAACTAGAGCGGTCTGATGCGTTATTCTCG
CTTGCCACTGAATTTCGCCCCAGCGTGCCCGACATTTCTCAAGACTCACCGCGTTTCGCCCTCTTTGACGTCTCT
GCTACCGTTTCCAACAACCGCCTCAGGCTTAGCTTTTTCTACAATCATCGTGCCGCTGACGTGCGCCCTGTTGAC
CTCTGGATTTCCAACTACGCAAAGACACTCGAGCGCCTTTCCTCCACGCTACCTTCTCAGCCGCTTACCTACACT
CTCGCCGATTTTCCTCTACTGCGCTGCAGCTATGCGGCTCTTGATAGGTTCGTTGAGGAGACGATTCCAAGGTGC
CAACTTTCCATGGACCAGGTGGAAGATGTCTATCCTTGCTCGCCTATTCAAAATGGGATGCTTCTGAGTCAAACG
AGATCAACCGCGGTTTACTATAATCGCTTTCTATTTAGGGTCAAGCCAAATTCGGGGACGGGCAACGTCTGCGAG
AAACGGTTTGCTCGTGCTTGGCGTCGAGTCGTTGCCAGGCATCCCATTCTGCGTACGTTTTTCATACCCAGTCTG
GGCCAAGGCAGCTTCATGGACCAGGTTGTACTACAAGAAGCGCGGGATGACATTGTCACCATGTTACCCATTGCC
AAAGACCCGTTGACGATACTCCAGAACCACTCTTCCGGCCTGCAGGCCCAAGGCGTCGTGCCTCATCATCTCACA
ACCTGCTGCTCACCGAACAGTGAACTGCTTGTTCTGCTGGAGATAGACCATTCCCTGCTAGACGGCACTTCGTTG
CAGATTCTGGTCCGAGACCTGCAGAGTGCCTACGACGACTCACTTCCGGCTCAAGCTGCAATGCCCTACAAAGAC
TACATCGCCTACGTCCAAAGCATCCCGACGGAGGAGGCCAAGCAATATTGGATGCGGTACTTGGAGGGAAGCAAC
CCTTGCCTGTTTCCCTCCATGTCGACGAATTCGGAATATCCCAAATGGCAATCCGCTGTTGCTCAGCTGGGGGCG
AGTTCTGATCTAACAAGGTTCTGCGAGGCCAACCACTTGACGCTGTCCAATGTGGTCCAAGTGGCCTGGGGACTG
GTCCTCCGGGCCTTTACAGGCTCAGACGATGTCTGCTTTGGCTATCTCACCTCGGGCCGTGATATTCCTCTCCCG
GGCGTCGAGGAGGCACTCGGGCCACTGATCAACATGCTCGTGTGTCGGATCGACTTCTCTAACGGCTCAACAATG
GCAGATCTGCTTCAACGCGCGCAGGAGGACCATGTCCAGAACAGCAGGCATCAGCATTTGTCTCTGGCCGAGATC
AAGGGCTCGCTTCAGCTGCCAGACATTCCGCTATTCAACACCATTGTCTCGCTACAACGAAGTGGAATGGTCCGG
GCGGTAGAGAGCAAAAGGTCCGTGGCAATTGAACCGGTCCAAGGAAAGGACCCAACCGAGTACGATATGACGGTC
AACGTGTGGGTTCATGAAGACTCCATCAAGCTTGTTCTCAACTACTGGACATCATTCACGACCGCAGGCCAAGCG
GCTACTGTGTTGGATACCTTGTCGCAGGCCATCTCGGAAATCAGGCTCAAGGTTTCCCAACGCGCAGCCGATATG
AATCTCTTGGGCCCTCGAAGCAGACAACAGGTTTGGCAGTGGAATCAACGTGTGCCGGCACGCATCGACCGCTGC
GCTCACGATCTCATCAGGGAGCGCAACCTGGAGCGAGCCGAAGAGCCAGCAGTCTGTGCCTGGAACGGTGACTTT
TCCCATGGTGAGCTGGACCAGAAAGCGTCCCAAGTAGCGGCCCATCTTGTGCGTGAGCACGGCGTGGAACCCGGC
GTCTTTGTCCCTGTCTACTTTGAAAAATCTAGATGGACTATAGTAGCCATTCTCGCCATTCTCAAATCCGGAGGC
GCCTTCGTCCTCATGGATCCCTCACATCCTGCTCAACGCTTGAGCGAAATTTGTCGAGATGTTGGTGCCGCCATC
GTCGTCACATCGGAATCTAAAGCAACCGATGCTGCCGAGCTGGGCCCTCAAGTTATTGTTATTGGCGACGGGGAA
TTTGCCTGGAAAGAGGCAGAGCCATTGAATGAGTTGAGAGCAAGGCCGAGCGACCCCATTTATGCCGTCTTCACG
TCAGGCTCAACTGGCAAGCCCAAGGGGGCTATCATGACACACGCGGCATGGTGTACGAGTGCAGAGGCTAACCGT
ATCGGACTGTTTGTGGAGAGTCGGTCGCGCGTTCTACAGTTTGCGTCGTACGCGTTCGACATCAGCATAGCCGAT
ATGCTTCTAACCCTCCTGGCAGGGGGCTGCGTTTGCGTGCCTTCGGACGAGGACCGCCAGTCTGACTTGATGGGC
GCCATCAACAATCTCGAAGCGAATTGGGCTTGCTTGACTCCTTCTATAACCCGAATTATTGAGCCGGGTATGGTT
CCGTCAGTCCACACCCTGGTCCTCTGCGGAGAGGCAGTGGCACCAGGAGACATCGCCAAGTGGAAGCCCCACGTC
CACCTCCTGAACCTGTATGGACCAGCTGAGTGTGCCATCTTGACGACGCTCAACCGATTCGTACATGACGAAAAA
GATGCCAACAACGTCGGCTATCCTACGAGTGCCGTGTGTTGGGTTGTCGATCCCGATGACTATGAAAAGCTGGTT
CCCGTCGGCCAGGTCGGCGAGCTCGTCGTCGAAGGTCCTATTGTCGGCCGCGAGTACATTGGCAATCCATCACAA
TCAGCAGCATCCTTTTTGCCCTGTCCTCTGTGGTTGCGACAGTTCCGGCCGTCGGCCGCGGGACCGATCTATAGG
ACTGGAGATCTGGTTCAGTACGTGGAAGACGGATCCCTTCGCAGTATTGGCCGCAAAGACACGCAGGTCAAGGTC
CGCGGCCAGCGCGTCGAACTGGGTGAGGTCGAGCACCACTTGCGGCAGTCTTTCCCTGATGCGCAGTATACGGTT
GCAGAGGTCATCCAAACGGGCGGCCGGCCTTCACTGGCCGCCTTTATCTACACCGGCGGACCAGAAGCAGACGAG
TCAGACGACGACAACATCTTTCGGGCCCCTGACGACCATTTCAACATGGCAGCAAGCAAGGCCGTGTCCCATCTT
CAGCGTGTCCTGCCCGTCTTCATGGTGCCTACGAGCTTCATCGCCTTGGCTCGAGCGCCGCTGACGAAGACGGGC
AAGATGGATCGTCGAACCCTGCGAGCCGCTGCCGCCAACCTGACACGGGAGCGTTTTGCCCAGACCAATCTCATC
CGGAAGAGAGCTCCCCGGACGCAGCGAGAGGGCCAACTGCGAAGTCTGTGTGCCGACGTGCTTGGGCTGCCTCCG
AGTGACGTGGGCATCGACGATCATTTCTTCCGCCTGGGCGGCGATTCGATCCTAGGCATGGCGCTCATCCACAAG
GCCCGCGAAGCTGGCTTGGCCATTACCATGGCCGACATCTTCACCAATCCCAAGGTGTGCGATCTGGCTGCGGCG
TCGACGCAAGCGACGCCATCTATAAGCTCTTCCATCTCGCCATTTGCCTTAGTCGATGACGCGGATACCATGGTT
CAACTGGCATCGGCCCAGTGTGGCATATCTGCCACCCAGATTGATGACATTTACCCCTGCACGCCGCTCCAGGAA
GGCCTCGTCGCCTTATCCGCCAAGCGACCGGGGCACTACATTGCGACGTTCGAGTTTACGCTGGCCGAATCAGTC
GACGTCAAGAGATTCATCGCTGCCTGGGACTCGGTGGTCGTCGCCAACCCCATCCTACGCACACGCGTCATCCAG
TCAGACTCGGGCTTCTTGCAAGCCGTCGTCAAGGATGCTGTTCCGTGGCAGTCGTTTGATGGTCCCGAGTCCTGT
CGGAAGCACGTGAACGCCACGAGTATGGGACTGGGCGACCCCCTGGTGCAGTTCGCCCTGGTCGAGTCTAGGGCA
TTTCACCTGACGCTCCATCATGCGCTGTACGACGGAGCCTCGCTGCCCAAACTCTGGAGCCAAGCCGAGGCTGCA
TACAAAGGCGTGTCTCTTCCTCCGAGGCCCTTCAACAGCTTCATCGGACACGTGCTCGCCGCTCGGGGCGGCGAC
TTTTGGCGGTCCGAGTTTGCGGGCTTCAACGGCCCCGTCTTCCCGACCCTTCCTCGGTCACGGTATATCCCGGAT
CCGGCTGCAGCGCTGGAACACAGAATCGCAGAGCTGGAGCTTGAGTCCATCGAGTATACCATTTCGACGGCCATC
CGGCTAGCCTGGGCCGTCGTCTTATCCTGCCACGCCGACTCAGACGATATCCTCTACGGCTTGACCGTCAATGGC
CGCAGCGCTCCCCTTGAGGGCATCGAAGATATCACGGGGCCGACTTTTGCCACATTCCCCGTACGCACTCGCGTC
AACCAAAGCGATACCGTCCAGACGGCCCTGGCAGCCATTCACCAACAGACGACTGCGGCCATGCCCTTCCAGCAG
TTTGGCATGCAAAACATGCGTCAGCTTAGTCCCGAGGCCGCCGCAGCATGCAGCTTCCAGTGTCACGTTACCATT
CAGCCATCGGGGGAGTATCCTCGGCATGGGCTTCTCGCTGACGTCCGGACCAAGCACGAGGACTATGGCAAGTTT
GCCAATTACGCTTTTGTCCCGATATGCCATCTCCCTGCCAAAGACGAGAGTGAGCTCCTCGTCACAGTCAGTCAC
GATGCCAACATTGTGCACCCGCTCCAGGCAAGAAGAATGGTTCAACAGTTTGAGCACGTCCTTCGCCAGCTGGTT
CGGCAACGATGCCAGTCTCTCTGTCTAGGCCAACTGGATCTGATCAGTCCGCAAGACCGACAACAACTGCTGGAA
TGGAACCGGGCTCTGGAAAAGCGAGGAGAAAGAGAGGGGGGAAGGGGACAGTGCCTCCATGAAATGGTCCTGAGC
TACGCCTCTAGCTTGCCCAAGGCTCCCGCAATCTCCGCGTGGGACGGCGACATGACATTCAGTCAACTTGACGCT
GCCACGGCCACGCTTGCTCGGCAATTTCAAAGTCTCGGAATCCAAGCTGGAGACTTTGTCGCGTTGCTGTTTGAT
AGATGCCGGTGGCTTGTTATCACCATGATTGCCCTTCACCGAATCGGAGCTGTCTGTGTCAACATTGATCCGACT
CTTCCGCGAGAGCACATTCAACAACTTCTCAACCTCTCCCGAGCCTCGTTCGTGTTGACGGGTCCTCAAGACCTG
GCCGAGATGGGCTTCGACAACACCACGGTTGCCACGGTCCCCATTGTCGGGGCGCAGCCTCAACCACACGAATTC
TCCGCTCCCAATGTCGACTGCCACGATGCCGCCTTCGTCACCTTTGCATGGGGAAGCAAAGGAGAGCCCGCGGGC
ACCATCACGGAGCACGCCAACTTGGCGACCTGGATCCGGGACAACAGTCACGAGGCCCGCCTGAATCCCGGCACC
CGCGGCCTACACTTTGCTCCGTACGCCTCTGAAGCCAGCATTTACGAAATCTTTGCTGTTCTAGCCAACGGGGGC
TGCATCTGCATTCCGTCCGAGTCGGACGACATTGTGTCGTTTATCAACAAGCATGGCATAAACTGGGCCCTCTTC
ACACCCTCGTTTCTGTCTCGGATGAGCCCGAATGCTATCCCTGGCGTCGGCACCATCCTTGTCAGCGGAGAGGCA
ACAGCCACGCAGAATATCGACGGGTGGGCGTCTCATGTCAATCTGGTTGCTACTAGATGTGGGCCGACAAAGACA
ACGCTTGCACCATCAGTTGAGAAGCAGGGCTCCCTTGTGCGCGTGACGGCCGGCGTTGGATGGATCGTCGTGCCG
TCGGAACCGTCTCGCCTCGTCCCAATCGGTGCCCCTGGCGAACTGGTCGTCGAAGGCCAATCACGGGATTCCGAA
AACACAAATCCTCCCTGGCTCGGACCGTTCCGAGAAGGCAATACGTCGAGTTCAAGACTCTATCGAACTGGTCAT
CTCGTCCAGTACAGCTCTGACGGGGCCCTTCTCTTCCTCGGCCGCCGAGACGCCCAAATCAAGCTCCGAGGCCAG
CGTATCGAGTTGGGCGAGGTGGAGCACCAAGTGCGGCGTGCGTTCCCCGGAATCTTGGACGTCGTGGCCGAAATC
ATCTCTCCGCATGATGGAGGAGGCTCTGCTTTCCTCGTGGCCTTTGTTGCCAGCGGCGTCGACTCCATGTCCGAG
AGCCTATTCGAAACTTGCAACGCAGAGTTCTTGGCCCAGGCCGAGGCAGCATCTCGCAGCATGGGGAAAGTCGTG
CCCGATCACATGGTTCCGGCCATCTTCGTGCGGCTTTCGGCCATGCCTCGTGACAAGCATGGCAAGGCAGACCGT
GGAAGGCTCCTGATGGAGGCCTCCAAGCTTTCCCAGCATCAACTGCAGGCTTTGTTCCGCCACGTCGACGTCGAC
ATAAAGCGGCGGAAGCCCGAAACGGCACAGGAGATACTGCTCCAGACCTTATGGGCCCAGGTGCTTACGATGGCT
CCCGACGATATCGGCCTAGACGATGACTTCTTCAATCTCCGTGGGGACTCCATCTCAGCCATGAAACTTGCGGGC
CTTGCTCGCCGCCACGGAAAACTCCTGCCCGTCTCGCGCATCTTCAAATTCCCAGTCCTTTCTGAGCAGGCCGCC
ATGATGGAGACGTCGAATGTCCATGACCCAGAAGACGAGTATAGACCCGGATCGCTGCTGGGCATCACTGACGTT
TCCGCTTTCTTCGACGACCAGCTTGGGGCACAGGCTCGCGCGTACAGAGGACAAGACGTCGAGGATGTCTTGCCC
ACGACTGAGACTCAAGCGTCTTTTCTCAGAAACAAGAACCTCACTCATACGCGTCTGCACTTGAGTACCGAGATT
GACGCTGACCGCCTCGACGCGGCTTGTCGAGCCCTTGTCCGCAAGCACGCCATACTACGAACTGTCTTCGTCGTC
CACGACGACGGCATTCTCCAAGTCGTCCTGCGAGATGTTCAGGTCCCACTGCTGCGACTGGAATGTAGCGAGGAT
CTCTGGCAATACTCGGAGAAGCTGTACGAACAAGATGCATCCTCGCCAGTTCCATTCGGCTCCCTCCACTTCCAG
CCGATACTGGTCTCAAGATCCGAGTCGGAGCACATGCTCATCCTCCGAATGACACACGCACAGTACGATGGAGGC
TCGATGCCGATGCTCTCCCAAGATTTGGCTCTGGCCTACGACGGTCACGAGCTGGCGGAGCGGCCCCCTTTCGCA
CACTTCCTGCGCTATCGTCAAAGGCAGGACACGACACAGACGCGTGAATTCTGGAGAGCGCACCTGCTCGGCTCC
GAAATGACGGACTACCGAGTGCTCTGCAAAGCGCCGCCGGCCGTGAGCAAGGAGCATGAAAGCGTGGTGAAGCCA
CTCCGAGAGACGGCTCTTCCGTCTCCTCCTCCAGGCGTCACCATGGCCTCGCTGGTCAAGGCAGCCTGGTCCGTG
GTGCTGGCCAGGGCAGCCGGCAAGACGGATATTGTGTTTGGCCACCTCATCAACGGCCGAGACGCGCTCCTGCAA
GGCATCCATGACATATCGGGCCCTTGCATCACCATGTCGCCCTTTAGGGTCGTGCTAGAGGAATCATGGACTTGG
ATGGATCTGCTCGGCCACGTTCAGGCGCAGTATCTCGAAAGCATGCCCTTCAGCCACTCCGACTTGGCCAAGATC
CGGAGACATTGCACCGCGTGGCCCGCAGACACCCACTTCGGCAGCGTCGTCACCCACCAAGACGCCAATATCGAT
CTGACGGGCTCCATCAACGGGTCGCCACCGTCCATCTGGCGCAACTTGAACCTAGGGATTCATTACGACTTTCAC
GTCGTCACCACCCCGGTCGAGGATAGGCTGCTTGTGCAGTTTTCCGTGTCGAGTGCCAAGATCAACCAGGACGAC
GCGGATACTACGATTGATGAGTTTTGCCGCATCATGGCTGAGATTTCGGCCGATCCTACACGTCCTATACAGCTC
Transcript >Ophio5|3418
ATGGAAACCAAATCGAACTGGTCGTACGAGACCAATGGAAACGGAAATGCAGGAGACTACCATGAGCCCATGTGC
GTCGACCTGGTCATTAAGCAACGGGCTCGGGACCAGCCAGGGGCAGTGGCTGTGTGTGCCTGGGACGGACAGCTG
AGCTACGCCGAGCTCGACGACCTGTCGACAGCCATGGCAATCCATTTGGCCAAAGGCGGAGTCAAGCCCGAGGCA
TATGTGCCCATTTACTCGGAAAAGTCGGTCTGGGTGCCGGTGGCGGCGTTGGCCGTGCTCAAGGCGGGCGGTGCC
TTTGTTCTGCTCGACATCTCGTACCCGGCAAGCCGACTCGAGACGATATGCCATACGGTTGGCGCCACCATTGTC
GTGGCATCCGAGAAAACGACGGACAAGGCGAAGAAACTGGCGGCCAAGGTCGTCGTGACGGGCATTTATGACAAT
GTCGACGACGGCTCGATTCAACGGGCCAAGCCCAGCAATGCCGCCTACGCCATCTTCACCTCGGGCACGTCCGGC
AAGCCCAAGGGCGTCACCATTGAGCATCAAGCCTTTTGCAGCAGCGCCTTTGAGCATGCCAAGGCCCTCGACATG
AATGCCTCTTCACGCGTGCTTCAATTTGCTTCGTATGCCTTTGACGCCTGTCTCACGGAAATGCTCGCAGCCCTG
ATGGTAGGCGCATGTGTGTGCATTCCATCCGAGCAAGACCGCGTGTTCCGTGTTCGGGACCATGTTCGCCAGCTC
CACGTCACCTGGGCTCTCCTGACGCCGTCTGTGAGCCGCGTCCTCGACGTAAGCGACCTGGCAGGTGTTAGGACT
CTCGTGCTGGGGGGGGAGGCGGTTCAGGTCGACGATATTACCAAGTGGACGCCTCACCTGGACCTATTCATCGCC
TACGGACTGACCGAATGTGCCGTTGTCAACATGGTCCACCCATGCCGCCAGGGAGACGTCGACGCTGCCAACTTG
GGCCACGGCGTTGGTGTTGATTGCTGGGTCGCTCAGCAGGACAACCATGGCCGTCTGGTCCAAGCAGGTCATGTA
GGAGAGCTTCTCCTCAGCGGGCCCTCAATCGGTCGCGGATACATCGACGACCCCGTCCGGACCGCTGACGCCTTC
ATCACAAAGACTCCCTGGTACTCAGGCTCATCCAGAATTTACAAGACAGGAGACCTCGTGATTTGTGACCCCATC
GACGGCACAATCCGCTATGTCGGACGTAAGGACACACAAGCCAAACTCTACGGTCAGCGATTCGAGGCAGCCGAG
ATCGAGCACCATATCCGGCGTCAGCTCCCTGCCTCGCAGCACATCGTAGTCCAAGTTGCACAGATCGACGAATCC
GAGACGCTTGTCGCCCTTGTCTCGCCGGCGGCGGCAAACTCTCCGGCGCAGGATGACTGGCTGCTGGATCCCACA
GACGAGTTTCGACATCAAGCGCGAATGACCCAACGAGCACTGCGCAACGTCATTCCCAGCTGGATGGTTCCAAGC
GTATTCCTACCCTTGGGTAGGATGCCGCTCACCGCGAGCGGCAAGTGTGACAGGAGGCAGCTGAGTTGCTGGATT
GCAAGCTTGTCCCGGACCCAGCTCCAGACATATGCTCTGTCGCGACCGACGGGTGCCAAGCATAAGGCCGAGAGC
CCGACGGAGAAGGTTGTCCGAGAACTCTGGGCCCAAATTTTGCAGATTGAAGCCGGCAACATTGTCAGGCAGGAT
AGCTTCTTCGACCTCGGCGGGAGCTCCATTGACGCACTGAAGCTTGCCAGTGCAGCCCGCAAGCAGGGCCTTGAC
CTCGCCTTGGACTGCCTGTATGGCAACGACAGTCTTGCCGCCATGGCAGCTTCTGTCCAGCCAGCTTCACAATCG
ACAATCCAACCATTCTCTCTCGTTGAAGAGCGAGAACCCGTCACAGAACGTGTGACGGAACTATGCCAGCTCATG
GACACATCTGATCTCGAGGACGTGTATCCTTGCACTCCTCTCCAGGAAGAACTCTTGTCGCTCACGGCCAAGCGG
CCTGGGGCGTACAGGGTTGCTTTTGAGTACGACCTCCCAGACGACGTTGACGCGAGTAGGTTCAAGAGGGCTTGG
GATGCCGTTGTCGAGGCCAATCCCATATTGAGAACCCGCTTCGTTCAGACAAGCACTGGGGCCATGTATCAGGCC
GTTATTCACGGATCGCTTCCTTGGTCGTCCCGGCATGAAGCTCTCTCGACATGGGATGGAGGAGCACTCGGACGA
CCGCTTATTCGTTTTTGCCTTGAGCCCGTAGACGGGAGGTATCAGTTCACCTTGGTCCTGCACCACGCCCTCAGC
GACGGATGGGCGTTGCAATTGATATTGCGCCAGGCACAAGAGGCATATGATGGAGCGACGCTTACGCCACGACCA
TTTGCCGCCTTCATCGAGTATGTAGGCAAGAGTCAGACCGAAGAGTGCGAGTCCTTCTGGAAAGGCCAGTTTGCC
GATCTTGAGGCGGCGACATTCCCTTCACTGTCATCGGCTGCGTATATACCCAACCTGATACGAAAGGAAACGGTC
ACGATGCCGGTCGAGTCTGCAACTTACCGCCAATTCGCCATCCCCAATAGGCTGACACTTGCCTGGGGCATTCTT
ATAACCCTCTACACAGACAGCCTGGACGCCGTGTTTGGCGTCACAGTGACCGGGCGCGGAGCACCCGTGCTGGGG
GTCGACGAAATGACGGGCCCAACAATTGCGACAGTCCCGTGCCGACTGCGGCTGAGTCCCGACATGACGATAGAA
GACGGGCTCTCGCAGGTGCAGAGAAACCGCTTTGCGGCGACTCCTTTTGAGCAGGCCGGGCTTCAGCGCATTAGC
CGCATGAGCGCCGATGCCAACTCGGCCTGCCGGTTTCAAAGCTTGCTCGTGATTCAGCCCAGGCAAGACGGACGC
CCGCCTCTGTTCCAAAGTGTCCGGGACCTAGCGGCCGTCGACGCCTTTAGCAGCTATGCCATCACCCTCATCTGC
TGGCAAATGGGCGACTCGGTCCAGGTAGAGGCGACGTTTGACGCGGGCGTTGTCGACGAGACGCAGATGCGAAGG
ATGCTGCACCAGCTGCGGCACATCTTCCTGCAACTCCGGCCGTCTGAAAGGCAGCTGCGCATCAAAGATGTGGAC
GTGACCAGCGCCGAGGATTGGGCCGAGCTGGCCAAGTGGAATCAGACTGTGTGCGAGCCTGTCCGCGCCTGCGCT
CATGATCTGGTCAGCGAGCAGGTCCAGCGTCAGCCCGACGCGCCGGCGGTGTGCGCCTGGGACGGCGACTTCACC
TATCGCCAGATGGAAGACTTGTCATCGCGCCTCGCTGCCCATCTCGTGGCCGAGGGCGTCGAAGCCGGCGTCTTC
GTGCCCCTCTGCTTCGAGAAGTCGCGCTGGGTGGCCGTGGCTATGTTGGCCGTCCTCAAAGCTGGGGGGGCCTTT
GTGCTGCTTGATCCGTCTTATCCGACCGAGCGATTGCGGACCATGTGCAGAGACTGCAGCGCCACCTTGATCGTG
ACGTCGAGCCAGCAGGCTACTCTGGCGCGGAGCCTCACGTCACGTGCCATCATCGTGGCTACCCATGGCGAGCAG
CGCTGGAAGGAGGAGCCGGCGACACCGTCTCGCCTACCGGCGCTGTTCATTCTCATATTTCGTGGTTTCGCCGCC
TACGCCTTCGATATTAGCATCGCCGACCATCTACTGACGCTCGTCGCCGGCGGATGCATCTGCATTCCGTCGCAG
CAAGACATCGAAGGCCGTATCAGCGAGGCCATCACCCGCCTAGGGGCTAATTGGGCCTGCCTTACCCCTTCTGTT
GCCCGCGTTATTGACCCGGCCAACACGCCCTCCCTGAGAAGACTCGTTTTATGCGGCGAGCCGCTTCCCGGTCAC
ATCGTCTCTTTATGGTCGCCTTACGCACATCTCCTGAATCTCTATGGCCCGGCCGAATGTGCCATCCTTACGACT
CTTCATCGCGACGTCCGTGACGCTACGGACCCAAACAACATTGCCTTTCCCACCAGCGCCGTCTGCTGGGTGGTA
GATGCCCAGAACGCGTATAGACTAGCCCCTCTAGGCACCGTTGGCGAGCTCCTTGTCGAGAGCCCTATCGTCGGA
CATGGCTATCTCAACGATGGGGAGCGGACGGCAGAGTCCTTCATCGCCCCCGACCAACGCCCGCGTTGGCTTAGG
CGTTTTCGGGCAGGGCAAAACTCGCGCCTGTACCTCACGGGGGATCTTGTCCAGTATACCAAAGACGGCTCGTTA
CGCTACATCGGTCGCAAGGACACTCAAATCAAGCTGCGCGGACAACGGGTTGAGCTGGGTGAGGTCGAGCATCAC
CTGCGCCGCTGCTTTCCCGGTGCCCAAGACGCCATCGCCGAGATTGTGGTGCGACGCCCAGGCAATCAGGCGGCC
GCCTTGACGGCCTTTATCTTGCCGGAGCAGACCATTTTCAAAATCCCAGACAAGCTTTTCCTCGCCCGCGCGGCA
GAGACACGGGGCCGCCTCGAGCTTGCAGTCCCGCCGTACATGGTGCCGGCTGTCTTTATCCCTGTCAACCAGTTT
CCCTATTCCACGTCGGGCAAACTGGACCGAAAACTGCTTCGCAGCCTGGCAGCTGACCTCTCTCTAGATGAGTAT
AGCAAGTCTCAGCAAAGCCAAAGTCAGGAGCTGTCTTCTAGCGAGGTCTCCGCCCCTCAGACACAGGCATATTCG
TCAAATGACGAGACCGTCAAGCGAGCGCCCTCGACTGATGTCGAGCAAACCATCCATGCAATCTGGGCACGCGTG
TTAGACATTGACAGCGAGTCTTTTGGTGTTGAAGATAACTTTTTCCGCCTCGGCGGAGATTCCATCGGCGCCATG
CGTGTCGTCGCTCAATGTGCTACTGCCGGGCTTCGAAGCTCCGTTGCGGCCCTCTTCAAGGCCAAGACGATTGCT
CAAATGAGCCTCACCATCGAGAAGATACACTCGACAATTTCAATACCTGCCGAGCGACTGGAAAAACGCTTTAGC
TTGTCACCAATCCAGCAACTGTTCTTCGACAATGCTGACGGCGACTTGAACCACTTCAACCAGTCCCTGTCATTT
CGCGTTCCTCACTCCGTGTCATCGCAGGCCATCCAGGAGGCTATTGAGTGGATTGTCGCGCACCATTCGATGCTT
CGTGCCCGATTCGTGCAGGAGGCCAATGGCCACTGGGAGCAATACATCAGCCGAGATGCTGCCAGCAGCCTTCTG
TATGAGGACGATCGGGCCAGGACGCGCCAAGAAGCGGCTTCTCTGATCGAAGCCGACCAGCGCAAACTGGATATT
CTAAGAGGGCCTTTGCTTGTCGCTCATGTCCTTTCCATTATCGACGTCGACGAGCTTCATCTCTCCCTGACTGTT
CACCACCTCGTTATGGACAATGTCTCTTGGAAAATCCTCCTTGCGGACCTTGAGCACCTGCTCGCAAGCCAAGGA
CCGCCCGCCCTGCCTCCACTTTCCTTCCAGGCCTGGTGTCAGCTGCAAGCCGCGTATACGAAGAAACACACTGAA
ACGATCGAGGTGCTGCCGCGGAATGCACTCACATTGAACGTACACGAATACTGGAGAGTTGACACCGACGACAAC
TGCTGGGGAAATACACTCGAGCAGGGCTTCAACCTTGGCGAGCAGGAAACCCAGACCCTTGTAGGTGATGCCGCG
AACAAGGCCTTTGGCACCCAGCCCGTCGAGATCTTGCACGCGGCCCTGCTCCAGGCATTTTTGCAGACATTTAAG
GACCGACCGAGCCCCATCATCTTCAGCGAAGGTCACGGTCGCGAGCCGTGGGACGCCAGCATCGACCCGACAGGG
ACCATCGGCTGGTTCACGACAATCTGGCCCGCCCATATTCCCGTCGAGCCGACCGACACGGTGCTTGAAATCGTG
CGCAAGACTAAGGACGCGCGCCGACAAATCAAGAGCAATGGATGGGCCTATTTCACGTCTCGCCAACTCGTCGGA
CCGAAGCCTGACGGCCCCATCGAGATTCTCTTCAACTATCATCCGGGCTTCACTGGGGGCTCCAAGGGGCTCTTG
CAGCCGTCTTCCTTGGTCGATGGACAATTGTTCCAGATGTCGCCTTCCATGCCACGGTTTGCCCTCATCAACGTC
ATGGCTGAAGTTGCCGACTCTCGGTTGTCGTTGAGCTTCATCTTCAATAAGCGAATGCAGTCATCCATGTCCAAG
TGGATTACACAAACCCAGTCGTGTCTCGAGGCCGCGGCATCCCTTTTGGTGGACAGAGCTGCTGCCCTCACCTTG
TCCGATTTCCCGCTCCTGTCATATTCGTATCCCGAGCTTGACGCCTTTAGCACCAACATTTTGGCCGCGATGGGT
GCCTCTGCAGACAACATCGAATACGTGTATCCTTGCTCACCGATACAAGAGGGCATGCTACTCAGCCAGGCCAAG
GTTTCGTCGCACTATCTCAACAGGGCGTTCTGGGTGCTAAGATCGCGAGGAAATGGCCCCGTGCGCGAAGAACAG
CTCAGGACCGCTTGGCTGCGCGTAGTGCAGAAGCACCCTCTCCTTCGCACCGTTATTTTCCGGAGTCCTCGTGAC
GACGGCCATCATGACCAGCTGGTGCTCAGGGAACCTCCGGACGGAATGTGTGTCGTGCTGCCCGCCTGCGAGGAT
CCGTTGCAGCGGCTCAAGGATCATCAATTCGACACACCCGAACTGAGTCCGCCTCACCGGTTTGCCATTTGCTCG
TCACACCATGGCGATGTGATGTGCCTGCTCGAGATCAGCCACGCATTAGTCGACGGCTTCTCCAGACAGCTGCTC
CTGCGTGATCTGTGCTCCGCATACGATGGCCCGCTCGTCAGAAATCATGCAGTGGGGACATATCGAGACTACGTT
GAATATCTTGAGTCTATCCCCCGGGAAGACGCCATCATCTTTTGGCAGAGCTACCTCAAGTCGGTGCAGCCATGC
AATCTTCCGCCTACGCCACCTCGTCAACCCTTTAACGACACCAAGCGGGTACACAACTTCAAACTATCCTCTGAC
CATGCGCTCCATCACTTTTGTGCTCAACAAGAGCTCACACTGGGCAACGTGCTGCAGCTGGCGTGGGCCTTGGTC
CTTCGGTTATATGTTGGTGCTGAATCCGTGTGCTTCGGGTACATGTCTGCAGGCAGAGATGTCCCCGTGCCCGGC
GTCGACGAAATCGTCGGCCCGCTTATCAACATCCTGATTTTCCGTCTTCCCATTGACGGCGGGGAGTCTCTACTC
GACTTGCTACGACAGAATCAGGCGGACTTTGTTCAGTGCTTGAAATACCAGCATCTTCTCACGGCGGATAAGATG
AAGGCAGCCGAAAAGTCGGATTCCAAGCTCTTCAACACCATCATGTCTGTCCAGAGAGAGATCGAGCCACGCCGA
GATGATTCGAGCGTGGAATTCGGGGAACTGGGTGGGGAGGACCCGACCGAGTACGATGTCATCCTCAATATCGGT
CTCCTGGAACAGGAAGTGAACGTGTCGCTTCAGTACCGCTTGGCTTTCATCTCCGACGAGCAGATCGAGAACATG
GCAGATGCGTTCCAGCAAGCCTTGCTTGACATCGTGGCAGAGCCGTCACAGACAGCCAGAACCATGAGTCTCTTT
GGCGCGCTAAGCTATCAACGCGTGACAGAGTACAACAGGCATGAGTTAGTACCTGTGAATGACTTTATCGACGAG
CTCATCGCGAGTCGCTGCCGCGCCCAACCTTTAGCCCTTGCGATTGACGCCTGCGACGGGAAGATAACGTATGGT
GAACTCGACGACTATTCCTCGCTTGTCGCTGCCGAATTGGCTCAACGTGACATCGGCCCAAACCGATTCGTTGCT
CTATGCTTCGAAAAGTCTCTTTGGACCACTGTGGCTCTACTGGGCGTGCTCAAAGCCGGCGCGGCTTTCATTCTT
CTGGATCCCTCTCACCCTCAGGAAAGGCTTCAGAGCATCTGCCGGGACGCCATCGTTGCAATAGTCTTGACATCG
AACAGCAACCGCAGCCTGGCCGCTCAGCTGGCATCTGAGACTCTGGACGTTGGAAAGCAGATTGTAAGCTGGAAG
ATGAAGGCCACGCCTCCAAATCGCGGCAGCCGGGACCCTAGCGATGTGGCATATCTCATCTTCACCTCGGGCTCT
ACTGGGAAGCCCAAAGGGGTCATGGTTCAACACGATGGACTGGCTACGAGCGCCTTATCACACGGCTCTGCCTTC
TTGATGAATACGAGCTCGCGAGTGCTTCAATTCGCTTCCTATGCATTTGACGCATCCATCGTGGATCAGATTACG
ACGCTCATTTTCGGAGGCTGCATCTGCATTCCTTCGGACGTCCAGAGACAAGATATTGCCAAGTCAGCAGCCGCC
TATGAGGCGAACTGGGTTAGTTTGACGCCGTCAGTTGCTAGAGCACTTGATCCCGCCGACTTTCAGACTCTTCAG
ACCCTCGTCTGCGGCGGTGAGTCTTTCAATGACAAGGTGATGAGCGCGTGGTTCCCCCACGTAAACTTCTTCACA
GCCTACGGGCCTTCAGAGTGCGCCATCATCTGTTCTGGGAACCTAATTACCAGCGAGTTTGATGATCTCCGCAAC
CTTGGACGCTTCTTTGCCAGCCATGCTTGGGTTGTGAGTCCTGATGATCCCAGCATCCTGCTTCCAGTCGGCGCG
GTAGGAGAACTAGTCGTCCAAGGCCACATTGTCGGTCGCGGCTACCTTCAGGACCCGGATAAAACCGCATACGCG
TTCATTGAACCACCGATGTGGTTGTCCAAATTCCGCAACGGCTCCGGGGGCCGTCTCTATAGGACTGGCGACATG
GTGCGTTACGTCAACGGCGAGGTTCAGTTTGTGGGTCGCAAAGACTCGCAGGTCAAGCTTCGGGGTCATCGTATC
GAACTGGGTGAGGTCGAGATTCATGTTCTGGCTTCCTTTGCCGGCGCTGTCCATGCCCTAGTAGAAGTCGTCACG
CCAGTGGATGGGGGCAAAGCACTTCTCGTCGCCTTCATACAAACGACGAATGAGTCCCCAGAGACGAACCACGAC
AGCCTCTTCGATAAGCCAAGCAAGCCTTTTGCTCTGAAGGCGCAGTCAGCCGAAACTCAGATGACAAAGTCCCTG
CCCATCTATATGATCCCTGTTCTCTTTCTGCCTCTACGATGGATGCCCCTGACTGGAACAGGCAAGGCGGACCGC
AACAGGCTTCGCTCAGCGGCCGCACGTCTTAGTGCCCAAGAGCTGGAGCAGTATGCCTTTTCCACGAGGCCTAAT
GTGATGCCATCGACCAAGGACGAGGCTTTACTCCAAAAAGTATGGGCACGTGTCTTGAACAAGGACCTTGCGTCT
GTTGGAATTCATCACAACTTCTTCAGACTTGGCGGCGACTCCATCAGTGCGATGCAAGTCACGTCGCGGTGCGCC
GCCGCAGGTCTCCGCGTCACTGTAGCCGACATTTTCCGGCACAAGACGATTGCGCAACTCGCCGCCGGCATGGAA
AAGTCATCGGCTTTGGATCTGCCATCAGAAAAGGTAGATTGCCCGTTTGAACTGTCTCCAATCCAGAAGCTGGTA
TTCCGGGTCGCTCCTCTAGGAAAACACCATTTCAATATGGGGTTTTTCCTTCGAATAGCACACATGATTCCCTCC
GACCATCTTGATGATGCGCTTCATCAACTTGTCCAACAGCACTCCATGCTCCGCGCCCGATTCTCCCAATCGCAG
GACGGTCATTGGGTGCAATCCATCTCTGCAGACGCGCCTGGCAGTTATCGCTTTCGTGCCTGTGACATTGATACG
ATGGACCAGGCTGGAGAAATCATCTCCGAGAGCGAACTCGCCGTCGATATTCAGCACGGCCCCATACTAGCAGTC
GATTTGATCAATGTTGGTAGCCAAAACCAATTCCTCTTTATTGTCGCCCACCATCTCGTGACGGACCTGGTTTCT
TGGCGAATCTTATTAGCAGATCTCGAGGACTATCTCACCAGGGGTTCCATCTCCAAGCCATCTCTTCCATTTCAA
ACATGGTGCCATCTACAGGCAGAGTACGCAGCCAGACATCTCGACCCGGAGCATGCAAGGCTTGACAATGGAGCC
GCACCACCTCCGGCTGATTACTGGGGAATCGCTAGACAGTCGAACTCGGTCAAGGATACTGCCCAGACAGCTTTT
ACCATTGACCAAGCAACGACCATCGGCTTGTTCGGGGCTGCTAATGAGGCCTTCCGAACACGACCCGTCGAGCTC
TTCCAAGCGGCTCTCCTCTTTTCCTTCGCCCAAGTTTTTAGAGATCGCTCGGCTCCGGTTTTGTGGAATGAGGGA
CACGGACGTGAACCGTGGACACGGCAGCTCGACCTCAGTAGAACCGTTGGGTGGTTCACCACGCTGTGGCCGGTG
GCCGTCGAAGCCGACGGACTCAGTCTCTTTGATGTCGTTCGCAGGACAAAGGACAAGTGCCGCAGCAGCCCAGAC
AACGGATGGGCACACTTTACCTCTTCTCTGCACCACAACGCAAGGCACATCGACGTCCGAGAAATCACTTTCAAC
TTTATAGGGCGCTTCCAGCAACTTGAACGCGAAGAGTCACTTTTCATGGCTCACCCAAGGCCCCCGTCCCGCATA
TCGGATATTTCCGAAGAATTGGGTCGTCTTTCAGTGATTGATGTCACGGCAGACGTTAGAGACGACTGCCTTGGT
TTCCAGTTTCACTACAACAAGTACGCCGCTGACAATCGGCCCATTCTGGATTGGATTATCGAGTGCAAACGGACA
CTCGTCAGAATGGCCGGGGAGCTACCAGAGCGGCCGGCGGAACACACGCTCAAGGATTTTCCCTTGTTGCCCTTT
ACGTACGACAGTCTTGACAGCTTCTTGGTTCACACTCTACCCAGCTATGGCGTCTCGCCGGCCAATGTCGAGGAC
GCATACCCGTGCTCTCCGATTCAGCGTGGGATCCTTCTCAGTTACGCCAAGCAGGCGCGTCACTACCAGACCTTT
CTTGTCTTCAAGGTTAAGCCCCAGAATGGTTCCGAGGCCGTAAGCCTTGACCGCGTCGTTGCGTCTTGGCAGAGA
ATTGTGTCGCGCCATGCCATCTTCAGGACAGTCTTTGTCGAGAGCATCTCGCAGGACAACTGGCTTGATCAAGTC
GTACTCAAAAAGGTGTCGGCTCACGTCAACATACTAAGTCCTGATGAAGAAGCAAGGATGATGACAGCGCTCTCA
GATGATCGGCAGCTCGCTGTCACTCGAGGACAACTCCCGTATCGGATGACGATGGGCCAAACAGTGACAGGAGAC
GTCTTGTGTGGCCTTGAAATGAGCCATTCGCTCTTTGATGGCGCATCCAGGCAGAATCTGCTTGCCGAGCTCGCC
TTGGCTTACGATGGCCCTCTTTCCTGTGTCCCTGGGCCGGCTTACCGTGACTACATAGCTTACCTCGAAAGCCGA
CCGGTCAAGTCGCATCAGCAGTACTGGGCCAAGTATCTTGAAGGCGTCGTACCTTGCCAAATCCCAGCTACCCCG
GATATAAGGATCAACTCTGCAGAGGATACACTGGGGTCTATCCACATTCACCTCGGGGACATGTCGGCTCTCCGG
CAGTTCTGCCAGTCCAATGAGTTGACACTATCCAACGTCTTTCAAGTTGTCTGGGGTGTAGTTTTGAGGGCATAC
ACCAATTCGGATGACGTTTGCTTCGGATATCTCTCTTCCGGCCGTGACGTGCCGGTTCCACAGGCTCATGAGATG
ATAGGCCCCCTCATTAACATGCTGGTCTGCCGCATGCAGATTGACGACTCGCAATCCTTAAGGGAAACACTCGAG
GCGGGCCAGGACTCGTTCGCCGAGAGTCTCAAGCACCAGCACTATCCCTTGGCCGAGATGCTTCGGGCCGCCAAC
ATTTCAGGCGGCAGGTCTCTCTTTAACACGGTCATGTCTCTCCAAACCATGGGCCGTACCAAGTCCAACGATACG
TCGTCTGTGCGCGTCGATGTGGTTGGGGGTGAAGATGCCTCAGAGTACAACATGACCATCCACGTCCTGGTTGAA
GTCGATGGCATAGACATCTTGCTGGAATACTGGCGATCATCACTTTCGGACGACCAGGCCAACCAAGTAGCCGAG
ACGCTGCGTCAAGTTGTCCTTCAAGTGGTTGACAAGGCGGACAATTCCATTGGAGACATCGAGCTGGTGAGCAAG
ACGAGTCTCGACACCTTGACCCAATGGAGTGGGACATTGCCGCCACCAGAATATACCCTTGTCCATGATCTCATC
CATGAACAGTGCCTCGCCCAGCCAGAAGCACCTGCTGTAGATGCTTGGGACGGCACTTTTACGTATCGCGAGGTC
GACGAGCTAAGCTCGAAGCTGGCGAACCACCTGGCGCACTTCAGGCTCGCCCCCGACTCCTTTATCCCTATTTGC
TTCGAAAAGTCTCGGTGGACGACGGTTGCCATGATGGCAGTCATGAAGACAGGCTGCGCCTTTATTCCTCTCGAT
CCTTCACAGCCCGTACAGCGCCTGCAAGACATTTGCCAGGGTGCGCAGGTTTCTGCGCTTGTCGCCTCTAAGGAG
CAGGCTCGCATAGCAGCATGTCTCGCCAAGCATGTGGTAACCGTCGGTGATGATGACCAAGACTGGAGGGAGACT
GATCCGGGGCATCAACTCGAATCATTTTCACCCAGAAATCTCCTCTACGCCATCTTCACGTCTGGGTCCACTGGC
AAGCCCAAGGGGGTAATGATTGAGCACTGCGCCTTTTCTTCAAGTGCGAAAGCGCATAGTAAGGCGCTGAATATC
ACCAAGGACTCTCGGGTGCTGCAATTTGCATCCTATGCCTTTGACGCGAGCGTGAGCGAGACGCTGACTACGCTA
CTGAAGGGCGGGTGTGTCTGTGTCCCTTCCGATGAGGAACGGAAGATTTCCCTCGCTGCGGTCGTTTCCAGGACG
CAGGCCAACTGGATGTTCATGACTCCTGCCGTTGCCAGAGTCTTGAACCCTGATGACTTTCCGTCTATCAAGACG
ATGCTTTGCGGTGGGGAAGTTGTCTCCGAGACGGAGCTGATGCTCTGGAGGGATGCTGTCGATCTGCGCCTCGTC
TATGGGCCAACCGAATGCGCCGTCTATTGCAGTGCCACCAACCAGGTTACGGCCGAGACGAGTGCCAGAAACTTG
GGCAGGCCTTTCGGATGCCGGTCTTGGGTCGTCAAGCCGCACAACCATCAGAAACCGGTCCCCATCGGCGCTGTG
GGTGAGCTGCTCATCGAAGGTCCCATTGTCTCTCGGGGATATCTCGACGACTCTGAAAGGACAGCCAGCGTCTTC
ATCGACCAGCCCGAGTTTCTCAAAACCCTTGGAGACACGCCATCTGCCATTTACAAGACTGGAGATCTTGTGAAG
TACAATGCCGACGGATCTCTGGAGTACGTATCAAGAAAGGATACCCAAGTCAAGCTCCGTGGTCAGCGCATCGAA
CTAGGCGAAGTCGAGCAACGGGCGCGGCAGTGCTTCCCTCGTTCGACAGACGTGGTTGTCGAACTCGTCGAGTCC
ATGGGCCCCTCGCGTCACCCGGCCCTGGTTGCTCTCATTCATACAGCAGCCGAGTTGCCGACCAAGGGTCAGGAC
ATACTCGCTGAGCCGTCGTCTTCGTTTCGGCAGGAGGCACAAGCAGCCGAGACAGCACTCACCGAAATGCTGCCC
AGTTACATGGTCCCCTCGTTCTATCTCCCCGTACACCGTATGCCACTCAGCAACAACGGCAAGGTTGACCGCCGG
CTCCTTCGACAGCTTGCCTCGACCCTTTCCGATGGCCAAGTCACGGCCTACAGTACCTCTCTGGGCGGCTCCAAA
CTCCAGCCGACGAGCGATGTTGAGCGACGACTGCGGGCCGTCTGGGCGCGGATCTTGAACCTAGAACCCGAGGCA
ATCGGCATTGACGACAGCTTCTTCCGCATTGGAGGTGACTCCATCAGCGCTATGCAGGTGGTGACGCAGTGCGCC
AACGAGCGACTTCAGCTTACGATGGCCGACTTCTTCCGATACAAGACCATCTCGGCCATCAGCCAGCAAACGACG
TGCTCGGTCGCACCGACTCAAGATATAGAGGTCCAGTACGAAAGCCCCTTTGACCTCTCTCCGATTCAGCAAATG
TTCTTCGAGACAGCTCCCGACGGTGTCAAGTACTTCAACCAGAGCTTCTTCCTCCGCCTCAACACGGACATCGAC
TCAGCTGTCCTACGCGATGCCATGACTCAACTCGTGACTCGCCATCACATGTTACGTGCTCGATTCAGGAAGACA
GTCAACGACACATCGAGAATTGGCGGATGCATGTGGCAACAGCTCATCAGTGATACAGTTGATGGTGCTTTTAGG
TATCAAGAGCATCAGGTTGCCCACCTGGAAGAGTCTCGCCTCATTCTCGTGACGGCCCAAACATTGCTAGACATG
CAGCATGGTCCTGTCTTTTCCGCTGACCTCGTTAATGTTGCCTCGGGCGGACAGTATCTCTTCATGGTGGCCCAC
CATCTGGTCGTCGACCTGGTCTCGTGGAGGATTATCATCCGTGACCTCGAGGATCTGCTCAAGACGAGGTCTATT
GTCTCTCCGCCCTCGATTTCTTTCCAGGCCTGGTGTCGACTTCAATCCGATTACGCCCTCGAGCATCTCACCCCA
GACTGTCCGCTTGCCGTACAAGTGCCTGCACCGATGCTAGACTACTGGGGTCTGTCGACTGGAAACAATCTTGTC
AGCGACATCGTCGAAAAGGAGCTTGTCCTTGGTGAGCAGGTGACACGCACTCTGCTCGGCACGGCCAACGATGCC
TTTCAGTCCAGGCCGGTCGAACTATTGCAAGCTGCCTTGATACACTCCTTTGCTTTGACTTTCCAGGACCGTCCT
CTACCAGCCATCTTTTCAGAAGGCCATGGCCGCGAGGCATGGGATTCAAGCATCAACTTGAATAGCACGGTGGGC
TGGTTCACCACGCTGTCGCCCACCGTTATCGAATCAACAGATTTGCTCGAGGCCGTTCGTCAGACCAAGGATCAG
CGCCGAAGGCTTCGTGACAACGGATGGGCGTACTTTACGTCGCGCTACTTGGGTTCTGCAGACCGGCTTTCCCTC
AAGACGCCTCTTGAAATCGTCTTCAACTTTACTGGCTCGTATCAGCAACTAGAGCGGTCTGATGCGTTATTCTCG
CTTGCCACTGAATTTCGCCCCAGCGTGCCCGACATTTCTCAAGACTCACCGCGTTTCGCCCTCTTTGACGTCTCT
GCTACCGTTTCCAACAACCGCCTCAGGCTTAGCTTTTTCTACAATCATCGTGCCGCTGACGTGCGCCCTGTTGAC
CTCTGGATTTCCAACTACGCAAAGACACTCGAGCGCCTTTCCTCCACGCTACCTTCTCAGCCGCTTACCTACACT
CTCGCCGATTTTCCTCTACTGCGCTGCAGCTATGCGGCTCTTGATAGGTTCGTTGAGGAGACGATTCCAAGGTGC
CAACTTTCCATGGACCAGGTGGAAGATGTCTATCCTTGCTCGCCTATTCAAAATGGGATGCTTCTGAGTCAAACG
AGATCAACCGCGGTTTACTATAATCGCTTTCTATTTAGGGTCAAGCCAAATTCGGGGACGGGCAACGTCTGCGAG
AAACGGTTTGCTCGTGCTTGGCGTCGAGTCGTTGCCAGGCATCCCATTCTGCGTACGTTTTTCATACCCAGTCTG
GGCCAAGGCAGCTTCATGGACCAGGTTGTACTACAAGAAGCGCGGGATGACATTGTCACCATGTTACCCATTGCC
AAAGACCCGTTGACGATACTCCAGAACCACTCTTCCGGCCTGCAGGCCCAAGGCGTCGTGCCTCATCATCTCACA
ACCTGCTGCTCACCGAACAGTGAACTGCTTGTTCTGCTGGAGATAGACCATTCCCTGCTAGACGGCACTTCGTTG
CAGATTCTGGTCCGAGACCTGCAGAGTGCCTACGACGACTCACTTCCGGCTCAAGCTGCAATGCCCTACAAAGAC
TACATCGCCTACGTCCAAAGCATCCCGACGGAGGAGGCCAAGCAATATTGGATGCGGTACTTGGAGGGAAGCAAC
CCTTGCCTGTTTCCCTCCATGTCGACGAATTCGGAATATCCCAAATGGCAATCCGCTGTTGCTCAGCTGGGGGCG
AGTTCTGATCTAACAAGGTTCTGCGAGGCCAACCACTTGACGCTGTCCAATGTGGTCCAAGTGGCCTGGGGACTG
GTCCTCCGGGCCTTTACAGGCTCAGACGATGTCTGCTTTGGCTATCTCACCTCGGGCCGTGATATTCCTCTCCCG
GGCGTCGAGGAGGCACTCGGGCCACTGATCAACATGCTCGTGTGTCGGATCGACTTCTCTAACGGCTCAACAATG
GCAGATCTGCTTCAACGCGCGCAGGAGGACCATGTCCAGAACAGCAGGCATCAGCATTTGTCTCTGGCCGAGATC
AAGGGCTCGCTTCAGCTGCCAGACATTCCGCTATTCAACACCATTGTCTCGCTACAACGAAGTGGAATGGTCCGG
GCGGTAGAGAGCAAAAGGTCCGTGGCAATTGAACCGGTCCAAGGAAAGGACCCAACCGAGTACGATATGACGGTC
AACGTGTGGGTTCATGAAGACTCCATCAAGCTTGTTCTCAACTACTGGACATCATTCACGACCGCAGGCCAAGCG
GCTACTGTGTTGGATACCTTGTCGCAGGCCATCTCGGAAATCAGGCTCAAGGTTTCCCAACGCGCAGCCGATATG
AATCTCTTGGGCCCTCGAAGCAGACAACAGGTTTGGCAGTGGAATCAACGTGTGCCGGCACGCATCGACCGCTGC
GCTCACGATCTCATCAGGGAGCGCAACCTGGAGCGAGCCGAAGAGCCAGCAGTCTGTGCCTGGAACGGTGACTTT
TCCCATGGTGAGCTGGACCAGAAAGCGTCCCAAGTAGCGGCCCATCTTGTGCGTGAGCACGGCGTGGAACCCGGC
GTCTTTGTCCCTGTCTACTTTGAAAAATCTAGATGGACTATAGTAGCCATTCTCGCCATTCTCAAATCCGGAGGC
GCCTTCGTCCTCATGGATCCCTCACATCCTGCTCAACGCTTGAGCGAAATTTGTCGAGATGTTGGTGCCGCCATC
GTCGTCACATCGGAATCTAAAGCAACCGATGCTGCCGAGCTGGGCCCTCAAGTTATTGTTATTGGCGACGGGGAA
TTTGCCTGGAAAGAGGCAGAGCCATTGAATGAGTTGAGAGCAAGGCCGAGCGACCCCATTTATGCCGTCTTCACG
TCAGGCTCAACTGGCAAGCCCAAGGGGGCTATCATGACACACGCGGCATGGTGTACGAGTGCAGAGGCTAACCGT
ATCGGACTGTTTGTGGAGAGTCGGTCGCGCGTTCTACAGTTTGCGTCGTACGCGTTCGACATCAGCATAGCCGAT
ATGCTTCTAACCCTCCTGGCAGGGGGCTGCGTTTGCGTGCCTTCGGACGAGGACCGCCAGTCTGACTTGATGGGC
GCCATCAACAATCTCGAAGCGAATTGGGCTTGCTTGACTCCTTCTATAACCCGAATTATTGAGCCGGGTATGGTT
CCGTCAGTCCACACCCTGGTCCTCTGCGGAGAGGCAGTGGCACCAGGAGACATCGCCAAGTGGAAGCCCCACGTC
CACCTCCTGAACCTGTATGGACCAGCTGAGTGTGCCATCTTGACGACGCTCAACCGATTCGTACATGACGAAAAA
GATGCCAACAACGTCGGCTATCCTACGAGTGCCGTGTGTTGGGTTGTCGATCCCGATGACTATGAAAAGCTGGTT
CCCGTCGGCCAGGTCGGCGAGCTCGTCGTCGAAGGTCCTATTGTCGGCCGCGAGTACATTGGCAATCCATCACAA
TCAGCAGCATCCTTTTTGCCCTGTCCTCTGTGGTTGCGACAGTTCCGGCCGTCGGCCGCGGGACCGATCTATAGG
ACTGGAGATCTGGTTCAGTACGTGGAAGACGGATCCCTTCGCAGTATTGGCCGCAAAGACACGCAGGTCAAGGTC
CGCGGCCAGCGCGTCGAACTGGGTGAGGTCGAGCACCACTTGCGGCAGTCTTTCCCTGATGCGCAGTATACGGTT
GCAGAGGTCATCCAAACGGGCGGCCGGCCTTCACTGGCCGCCTTTATCTACACCGGCGGACCAGAAGCAGACGAG
TCAGACGACGACAACATCTTTCGGGCCCCTGACGACCATTTCAACATGGCAGCAAGCAAGGCCGTGTCCCATCTT
CAGCGTGTCCTGCCCGTCTTCATGGTGCCTACGAGCTTCATCGCCTTGGCTCGAGCGCCGCTGACGAAGACGGGC
AAGATGGATCGTCGAACCCTGCGAGCCGCTGCCGCCAACCTGACACGGGAGCGTTTTGCCCAGACCAATCTCATC
CGGAAGAGAGCTCCCCGGACGCAGCGAGAGGGCCAACTGCGAAGTCTGTGTGCCGACGTGCTTGGGCTGCCTCCG
AGTGACGTGGGCATCGACGATCATTTCTTCCGCCTGGGCGGCGATTCGATCCTAGGCATGGCGCTCATCCACAAG
GCCCGCGAAGCTGGCTTGGCCATTACCATGGCCGACATCTTCACCAATCCCAAGGTGTGCGATCTGGCTGCGGCG
TCGACGCAAGCGACGCCATCTATAAGCTCTTCCATCTCGCCATTTGCCTTAGTCGATGACGCGGATACCATGGTT
CAACTGGCATCGGCCCAGTGTGGCATATCTGCCACCCAGATTGATGACATTTACCCCTGCACGCCGCTCCAGGAA
GGCCTCGTCGCCTTATCCGCCAAGCGACCGGGGCACTACATTGCGACGTTCGAGTTTACGCTGGCCGAATCAGTC
GACGTCAAGAGATTCATCGCTGCCTGGGACTCGGTGGTCGTCGCCAACCCCATCCTACGCACACGCGTCATCCAG
TCAGACTCGGGCTTCTTGCAAGCCGTCGTCAAGGATGCTGTTCCGTGGCAGTCGTTTGATGGTCCCGAGTCCTGT
CGGAAGCACGTGAACGCCACGAGTATGGGACTGGGCGACCCCCTGGTGCAGTTCGCCCTGGTCGAGTCTAGGGCA
TTTCACCTGACGCTCCATCATGCGCTGTACGACGGAGCCTCGCTGCCCAAACTCTGGAGCCAAGCCGAGGCTGCA
TACAAAGGCGTGTCTCTTCCTCCGAGGCCCTTCAACAGCTTCATCGGACACGTGCTCGCCGCTCGGGGCGGCGAC
TTTTGGCGGTCCGAGTTTGCGGGCTTCAACGGCCCCGTCTTCCCGACCCTTCCTCGGTCACGGTATATCCCGGAT
CCGGCTGCAGCGCTGGAACACAGAATCGCAGAGCTGGAGCTTGAGTCCATCGAGTATACCATTTCGACGGCCATC
CGGCTAGCCTGGGCCGTCGTCTTATCCTGCCACGCCGACTCAGACGATATCCTCTACGGCTTGACCGTCAATGGC
CGCAGCGCTCCCCTTGAGGGCATCGAAGATATCACGGGGCCGACTTTTGCCACATTCCCCGTACGCACTCGCGTC
AACCAAAGCGATACCGTCCAGACGGCCCTGGCAGCCATTCACCAACAGACGACTGCGGCCATGCCCTTCCAGCAG
TTTGGCATGCAAAACATGCGTCAGCTTAGTCCCGAGGCCGCCGCAGCATGCAGCTTCCAGTGTCACGTTACCATT
CAGCCATCGGGGGAGTATCCTCGGCATGGGCTTCTCGCTGACGTCCGGACCAAGCACGAGGACTATGGCAAGTTT
GCCAATTACGCTTTTGTCCCGATATGCCATCTCCCTGCCAAAGACGAGAGTGAGCTCCTCGTCACAGTCAGTCAC
GATGCCAACATTGTGCACCCGCTCCAGGCAAGAAGAATGGTTCAACAGTTTGAGCACGTCCTTCGCCAGCTGGTT
CGGCAACGATGCCAGTCTCTCTGTCTAGGCCAACTGGATCTGATCAGTCCGCAAGACCGACAACAACTGCTGGAA
TGGAACCGGGCTCTGGAAAAGCGAGGAGAAAGAGAGGGGGGAAGGGGACAGTGCCTCCATGAAATGGTCCTGAGC
TACGCCTCTAGCTTGCCCAAGGCTCCCGCAATCTCCGCGTGGGACGGCGACATGACATTCAGTCAACTTGACGCT
GCCACGGCCACGCTTGCTCGGCAATTTCAAAGTCTCGGAATCCAAGCTGGAGACTTTGTCGCGTTGCTGTTTGAT
AGATGCCGGTGGCTTGTTATCACCATGATTGCCCTTCACCGAATCGGAGCTGTCTGTGTCAACATTGATCCGACT
CTTCCGCGAGAGCACATTCAACAACTTCTCAACCTCTCCCGAGCCTCGTTCGTGTTGACGGGTCCTCAAGACCTG
GCCGAGATGGGCTTCGACAACACCACGGTTGCCACGGTCCCCATTGTCGGGGCGCAGCCTCAACCACACGAATTC
TCCGCTCCCAATGTCGACTGCCACGATGCCGCCTTCGTCACCTTTGCATGGGGAAGCAAAGGAGAGCCCGCGGGC
ACCATCACGGAGCACGCCAACTTGGCGACCTGGATCCGGGACAACAGTCACGAGGCCCGCCTGAATCCCGGCACC
CGCGGCCTACACTTTGCTCCGTACGCCTCTGAAGCCAGCATTTACGAAATCTTTGCTGTTCTAGCCAACGGGGGC
TGCATCTGCATTCCGTCCGAGTCGGACGACATTGTGTCGTTTATCAACAAGCATGGCATAAACTGGGCCCTCTTC
ACACCCTCGTTTCTGTCTCGGATGAGCCCGAATGCTATCCCTGGCGTCGGCACCATCCTTGTCAGCGGAGAGGCA
ACAGCCACGCAGAATATCGACGGGTGGGCGTCTCATGTCAATCTGGTTGCTACTAGATGTGGGCCGACAAAGACA
ACGCTTGCACCATCAGTTGAGAAGCAGGGCTCCCTTGTGCGCGTGACGGCCGGCGTTGGATGGATCGTCGTGCCG
TCGGAACCGTCTCGCCTCGTCCCAATCGGTGCCCCTGGCGAACTGGTCGTCGAAGGCCAATCACGGGATTCCGAA
AACACAAATCCTCCCTGGCTCGGACCGTTCCGAGAAGGCAATACGTCGAGTTCAAGACTCTATCGAACTGGTCAT
CTCGTCCAGTACAGCTCTGACGGGGCCCTTCTCTTCCTCGGCCGCCGAGACGCCCAAATCAAGCTCCGAGGCCAG
CGTATCGAGTTGGGCGAGGTGGAGCACCAAGTGCGGCGTGCGTTCCCCGGAATCTTGGACGTCGTGGCCGAAATC
ATCTCTCCGCATGATGGAGGAGGCTCTGCTTTCCTCGTGGCCTTTGTTGCCAGCGGCGTCGACTCCATGTCCGAG
AGCCTATTCGAAACTTGCAACGCAGAGTTCTTGGCCCAGGCCGAGGCAGCATCTCGCAGCATGGGGAAAGTCGTG
CCCGATCACATGGTTCCGGCCATCTTCGTGCGGCTTTCGGCCATGCCTCGTGACAAGCATGGCAAGGCAGACCGT
GGAAGGCTCCTGATGGAGGCCTCCAAGCTTTCCCAGCATCAACTGCAGGCTTTGTTCCGCCACGTCGACGTCGAC
ATAAAGCGGCGGAAGCCCGAAACGGCACAGGAGATACTGCTCCAGACCTTATGGGCCCAGGTGCTTACGATGGCT
CCCGACGATATCGGCCTAGACGATGACTTCTTCAATCTCCGTGGGGACTCCATCTCAGCCATGAAACTTGCGGGC
CTTGCTCGCCGCCACGGAAAACTCCTGCCCGTCTCGCGCATCTTCAAATTCCCAGTCCTTTCTGAGCAGGCCGCC
ATGATGGAGACGTCGAATGTCCATGACCCAGAAGACGAGTATAGACCCGGATCGCTGCTGGGCATCACTGACGTT
TCCGCTTTCTTCGACGACCAGCTTGGGGCACAGGCTCGCGCGTACAGAGGACAAGACGTCGAGGATGTCTTGCCC
ACGACTGAGACTCAAGCGTCTTTTCTCAGAAACAAGAACCTCACTCATACGCGTCTGCACTTGAGTACCGAGATT
GACGCTGACCGCCTCGACGCGGCTTGTCGAGCCCTTGTCCGCAAGCACGCCATACTACGAACTGTCTTCGTCGTC
CACGACGACGGCATTCTCCAAGTCGTCCTGCGAGATGTTCAGGTCCCACTGCTGCGACTGGAATGTAGCGAGGAT
CTCTGGCAATACTCGGAGAAGCTGTACGAACAAGATGCATCCTCGCCAGTTCCATTCGGCTCCCTCCACTTCCAG
CCGATACTGGTCTCAAGATCCGAGTCGGAGCACATGCTCATCCTCCGAATGACACACGCACAGTACGATGGAGGC
TCGATGCCGATGCTCTCCCAAGATTTGGCTCTGGCCTACGACGGTCACGAGCTGGCGGAGCGGCCCCCTTTCGCA
CACTTCCTGCGCTATCGTCAAAGGCAGGACACGACACAGACGCGTGAATTCTGGAGAGCGCACCTGCTCGGCTCC
GAAATGACGGACTACCGAGTGCTCTGCAAAGCGCCGCCGGCCGTGAGCAAGGAGCATGAAAGCGTGGTGAAGCCA
CTCCGAGAGACGGCTCTTCCGTCTCCTCCTCCAGGCGTCACCATGGCCTCGCTGGTCAAGGCAGCCTGGTCCGTG
GTGCTGGCCAGGGCAGCCGGCAAGACGGATATTGTGTTTGGCCACCTCATCAACGGCCGAGACGCGCTCCTGCAA
GGCATCCATGACATATCGGGCCCTTGCATCACCATGTCGCCCTTTAGGGTCGTGCTAGAGGAATCATGGACTTGG
ATGGATCTGCTCGGCCACGTTCAGGCGCAGTATCTCGAAAGCATGCCCTTCAGCCACTCCGACTTGGCCAAGATC
CGGAGACATTGCACCGCGTGGCCCGCAGACACCCACTTCGGCAGCGTCGTCACCCACCAAGACGCCAATATCGAT
CTGACGGGCTCCATCAACGGGTCGCCACCGTCCATCTGGCGCAACTTGAACCTAGGGATTCATTACGACTTTCAC
GTCGTCACCACCCCGGTCGAGGATAGGCTGCTTGTGCAGTTTTCCGTGTCGAGTGCCAAGATCAACCAGGACGAC
GCGGATACTACGATTGATGAGTTTTGCCGCATCATGGCTGAGATTTCGGCCGATCCTACACGTCCTATACAGCTC
TGA
Gene >Ophio5|3418
ATGGAAACCAAATCGAACTGGTCGTACGAGACCAATGGAAACGGAAATGCAGGAGACTACCATGAGCCCATGTGC
GTCGACCTGGTCATTAAGCAACGGGCTCGGGACCAGCCAGGGGCAGTGGCTGTGTGTGCCTGGGACGGACAGCTG
AGCTACGCCGAGCTCGACGACCTGTCGACAGCCATGGCAATCCATTTGGCCAAAGGCGGAGTCAAGCCCGAGGCA
TATGTGCCCATTTACTCGGAAAAGTCGGTCTGGGTGCCGGTGGCGGCGTTGGCCGTGCTCAAGGCGGGCGGTGCC
TTTGTTCTGCTCGACATCTCGTACCCGGCAAGCCGACTCGAGACGATATGCCATACGGTTGGCGCCACCATTGTC
GTGGCATCCGAGAAAACGACGGACAAGGCGAAGAAACTGGCGGCCAAGGTCGTCGTGACGGGCATTTATGACAAT
GTCGACGACGGCTCGATTCAACGGGCCAAGCCCAGCAATGCCGCCTACGCCATCTTCACCTCGGGCACGTCCGGC
AAGCCCAAGGGCGTCACCATTGAGCATCAAGCCTTTTGCAGCAGCGCCTTTGAGCATGCCAAGGCCCTCGACATG
AATGCCTCTTCACGCGTGCTTCAATTTGCTTCGTATGCCTTTGACGCCTGTCTCACGGAAATGCTCGCAGCCCTG
ATGGTAGGCGCATGTGTGTGCATTCCATCCGAGCAAGACCGCGTGTTCCGTGTTCGGGACCATGTTCGCCAGCTC
CACGTCACCTGGGCTCTCCTGACGCCGTCTGTGAGCCGCGTCCTCGACGTAAGCGACCTGGCAGGTGTTAGGACT
CTCGTGCTGGGGGGGGAGGCGGTTCAGGTCGACGATATTACCAAGTGGACGCCTCACCTGGACCTATTCATCGCC
TACGGACTGACCGAATGTGCCGTTGTCAACATGGTCCACCCATGCCGCCAGGGAGACGTCGACGCTGCCAACTTG
GGCCACGGCGTTGGTGTTGATTGCTGGGTCGCTCAGCAGGACAACCATGGCCGTCTGGTCCAAGCAGGTCATGTA
GGAGAGCTTCTCCTCAGCGGGCCCTCAATCGGTCGCGGATACATCGACGACCCCGTCCGGACCGCTGACGCCTTC
ATCACAAAGACTCCCTGGTACTCAGGCTCATCCAGAATTTACAAGACAGGAGACCTCGTGATTTGTGACCCCATC
GACGGCACAATCCGCTATGTCGGACGTAAGGACACACAAGCCAAACTCTACGGTCAGCGATTCGAGGCAGCCGAG
ATCGAGCACCATATCCGGCGTCAGCTCCCTGCCTCGCAGCACATCGTAGTCCAAGTTGCACAGATCGACGAATCC
GAGACGCTTGTCGCCCTTGTCTCGCCGGCGGCGGCAAACTCTCCGGCGCAGGATGACTGGCTGCTGGATCCCACA
GACGAGTTTCGACATCAAGCGCGAATGACCCAACGAGCACTGCGCAACGTCATTCCCAGCTGGATGGTTCCAAGC
GTATTCCTACCCTTGGGTAGGATGCCGCTCACCGCGAGCGGCAAGTGTGACAGGAGGCAGCTGAGTTGCTGGATT
GCAAGCTTGTCCCGGACCCAGCTCCAGACATATGCTCTGTCGCGACCGACGGGTGCCAAGCATAAGGCCGAGAGC
CCGACGGAGAAGGTTGTCCGAGAACTCTGGGCCCAAATTTTGCAGATTGAAGCCGGCAACATTGTCAGGCAGGAT
AGCTTCTTCGACCTCGGCGGGAGCTCCATTGACGCACTGAAGCTTGCCAGTGCAGCCCGCAAGCAGGGCCTTGAC
CTCGCCTTGGACTGCCTGTATGGCAACGACAGTCTTGCCGCCATGGCAGCTTCTGTCCAGCCAGCTTCACAATCG
ACAATCCAACCATTCTCTCTCGTTGAAGAGCGAGAACCCGTCACAGAACGTGTGACGGAACTATGCCAGCTCATG
GACACATCTGATCTCGAGGACGTGTATCCTTGCACTCCTCTCCAGGAAGAACTCTTGTCGCTCACGGCCAAGCGG
CCTGGGGCGTACAGGGTTGCTTTTGAGTACGACCTCCCAGACGACGTTGACGCGAGTAGGTTCAAGAGGGCTTGG
GATGCCGTTGTCGAGGCCAATCCCATATTGAGAACCCGCTTCGTTCAGACAAGCACTGGGGCCATGTATCAGGCC
GTTATTCACGGATCGCTTCCTTGGTCGTCCCGGCATGAAGCTCTCTCGACATGGGATGGAGGAGCACTCGGACGA
CCGCTTATTCGTTTTTGCCTTGAGCCCGTAGACGGGAGGTATCAGTTCACCTTGGTCCTGCACCACGCCCTCAGC
GACGGATGGGCGTTGCAATTGATATTGCGCCAGGCACAAGAGGCATATGATGGAGCGACGCTTACGCCACGACCA
TTTGCCGCCTTCATCGAGTATGTAGGCAAGAGTCAGACCGAAGAGTGCGAGTCCTTCTGGAAAGGCCAGTTTGCC
GATCTTGAGGCGGCGACATTCCCTTCACTGTCATCGGCTGCGTATATACCCAACCTGATACGAAAGGAAACGGTC
ACGATGCCGGTCGAGTCTGCAACTTACCGCCAATTCGCCATCCCCAATAGGCTGACACTTGCCTGGGGCATTCTT
ATAACCCTCTACACAGACAGCCTGGACGCCGTGTTTGGCGTCACAGTGACCGGGCGCGGAGCACCCGTGCTGGGG
GTCGACGAAATGACGGGCCCAACAATTGCGACAGTCCCGTGCCGACTGCGGCTGAGTCCCGACATGACGATAGAA
GACGGGCTCTCGCAGGTGCAGAGAAACCGCTTTGCGGCGACTCCTTTTGAGCAGGCCGGGCTTCAGCGCATTAGC
CGCATGAGCGCCGATGCCAACTCGGCCTGCCGGTTTCAAAGCTTGCTCGTGATTCAGCCCAGGCAAGACGGACGC
CCGCCTCTGTTCCAAAGTGTCCGGGACCTAGCGGCCGTCGACGCCTTTAGCAGCTATGCCATCACCCTCATCTGC
TGGCAAATGGGCGACTCGGTCCAGGTAGAGGCGACGTTTGACGCGGGCGTTGTCGACGAGACGCAGATGCGAAGG
ATGCTGCACCAGCTGCGGCACATCTTCCTGCAACTCCGGCCGTCTGAAAGGCAGCTGCGCATCAAAGATGTGGAC
GTGACCAGCGCCGAGGATTGGGCCGAGCTGGCCAAGTGGAATCAGACTGTGTGCGAGCCTGTCCGCGCCTGCGCT
CATGATCTGGTCAGCGAGCAGGTCCAGCGTCAGCCCGACGCGCCGGCGGTGTGCGCCTGGGACGGCGACTTCACC
TATCGCCAGATGGAAGACTTGTCATCGCGCCTCGCTGCCCATCTCGTGGCCGAGGGCGTCGAAGCCGGCGTCTTC
GTGCCCCTCTGCTTCGAGAAGTCGCGCTGGGTGGCCGTGGCTATGTTGGCCGTCCTCAAAGCTGGGGGGGCCTTT
GTGCTGCTTGATCCGTCTTATCCGACCGAGCGATTGCGGACCATGTGCAGAGACTGCAGCGCCACCTTGATCGTG
ACGTCGAGCCAGCAGGCTACTCTGGCGCGGAGCCTCACGTCACGTGCCATCATCGTGGCTACCCATGGCGAGCAG
CGCTGGAAGGAGGAGCCGGCGACACCGTCTCGCCTACCGTCCGTCAAGCCCGAGTCCAGCATCTACGCCGTCTTC
ACCTCGGGCTCGTCCAGCACTCCAAAGGGCGCTGTTCATTCTCATATTTCGTGGTGTACGAGTGCCCTGGCGAAC
CGCGTCGGCCTGTTCCTCGACCAGAGCTCACGCGTGTTCCAGTTCGCCGCCTACGCCTTCGATATTAGCATCGCC
GACCATCTACTGACGCTCGTCGCCGGCGGATGCATCTGCATTCCGTCGCAGCAAGACATCGAAGGCCGTATCAGC
GAGGCCATCACCCGCCTAGGGGCTAATTGGGCCTGCCTTACCCCTTCTGTTGCCCGCGTTATTGACCCGGCCAAC
ACGCCCTCCCTGAGAAGACTCGTTTTATGCGGCGAGCCGCTTCCCGGTCACATCGTCTCTTTATGGTCGCCTTAC
GCACATCTCCTGAATCTCTATGGCCCGGCCGAATGTGCCATCCTTACGACTCTTCATCGCGACGTCCGTGACGCT
ACGGACCCAAACAACATTGCCTTTCCCACCAGCGCCGTCTGCTGGGTGGTAGATGCCCAGAACGCGTATAGACTA
GCCCCTCTAGGCACCGTTGGCGAGCTCCTTGTCGAGAGCCCTATCGTCGGACATGGCTATCTCAACGATGGGGAG
CGGACGGCAGAGTCCTTCATCGCCCCCGACCAACGCCCGCGTTGGCTTAGGCGTTTTCGGGCAGGGCAAAACTCG
CGCCTGTACCTCACGGGGGATCTTGTCCAGTATACCAAAGACGGCTCGTTACGCTACATCGGTCGCAAGGACACT
CAAATCAAGCTGCGCGGACAACGGGTTGAGCTGGGTGAGGTCGAGCATCACCTGCGCCGCTGCTTTCCCGGTGCC
CAAGACGCCATCGCCGAGATTGTGGTGCGACGCCCAGGCAATCAGGCGGCCGCCTTGACGGCCTTTATCTTGCCG
GAGCAGACCATTTTCAAAATCCCAGACAAGCTTTTCCTCGCCCGCGCGGCAGAGACACGGGGCCGCCTCGAGCTT
GCAGTCCCGCCGTACATGGTGCCGGCTGTCTTTATCCCTGTCAACCAGTTTCCCTATTCCACGTCGGGCAAACTG
GACCGAAAACTGCTTCGCAGCCTGGCAGCTGACCTCTCTCTAGATGAGTATAGCAAGTCTCAGCAAAGCCAAAGT
CAGGAGCTGTCTTCTAGCGAGGTCTCCGCCCCTCAGACACAGGCATATTCGTCAAATGACGAGACCGTCAAGCGA
GCGCCCTCGACTGATGTCGAGCAAACCATCCATGCAATCTGGGCACGCGTGTTAGACATTGACAGCGAGTCTTTT
GGTGTTGAAGATAACTTTTTCCGCCTCGGCGGAGATTCCATCGGCGCCATGCGTGTCGTCGCTCAATGTGCTACT
GCCGGGCTTCGAAGCTCCGTTGCGGCCCTCTTCAAGGCCAAGACGATTGCTCAAATGAGCCTCACCATCGAGAAG
ATACACTCGACAATTTCAATACCTGCCGAGCGACTGGAAAAACGCTTTAGCTTGTCACCAATCCAGCAACTGTTC
TTCGACAATGCTGACGGCGACTTGAACCACTTCAACCAGTCCCTGTCATTTCGCGTTCCTCACTCCGTGTCATCG
CAGGCCATCCAGGAGGCTATTGAGTGGATTGTCGCGCACCATTCGATGCTTCGTGCCCGATTCGTGCAGGAGGCC
AATGGCCACTGGGAGCAATACATCAGCCGAGATGCTGCCAGCAGCCTTCTGTATGAGGACGATCGGGCCAGGACG
CGCCAAGAAGCGGCTTCTCTGATCGAAGCCGACCAGCGCAAACTGGATATTCTAAGAGGGCCTTTGCTTGTCGCT
CATGTCCTTTCCATTATCGACGTCGACGAGCTTCATCTCTCCCTGACTGTTCACCACCTCGTTATGGACAATGTC
TCTTGGAAAATCCTCCTTGCGGACCTTGAGCACCTGCTCGCAAGCCAAGGACCGCCCGCCCTGCCTCCACTTTCC
TTCCAGGCCTGGTGTCAGCTGCAAGCCGCGTATACGAAGAAACACACTGAAACGATCGAGGTGCTGCCGCGGAAT
GCACTCACATTGAACGTACACGAATACTGGAGAGTTGACACCGACGACAACTGCTGGGGAAATACACTCGAGCAG
GGCTTCAACCTTGGCGAGCAGGAAACCCAGACCCTTGTAGGTGATGCCGCGAACAAGGCCTTTGGCACCCAGCCC
GTCGAGATCTTGCACGCGGCCCTGCTCCAGGCATTTTTGCAGACATTTAAGGACCGACCGAGCCCCATCATCTTC
AGCGAAGGTCACGGTCGCGAGCCGTGGGACGCCAGCATCGACCCGACAGGGACCATCGGCTGGTTCACGACAATC
TGGCCCGCCCATATTCCCGTCGAGCCGACCGACACGGTGCTTGAAATCGTGCGCAAGACTAAGGACGCGCGCCGA
CAAATCAAGAGCAATGGATGGGCCTATTTCACGTCTCGCCAACTCGTCGGACCGAAGCCTGACGGCCCCATCGAG
ATTCTCTTCAACTATCATCCGGGCTTCACTGGGGGCTCCAAGGGGCTCTTGCAGCCGTCTTCCTTGGTCGATGGA
CAATTGTTCCAGATGTCGCCTTCCATGCCACGGTTTGCCCTCATCAACGTCATGGCTGAAGTTGCCGACTCTCGG
TTGTCGTTGAGCTTCATCTTCAATAAGCGAATGCAGTCATCCATGTCCAAGTGGATTACACAAACCCAGTCGTGT
CTCGAGGCCGCGGCATCCCTTTTGGTGGACAGAGCTGCTGCCCTCACCTTGTCCGATTTCCCGCTCCTGTCATAT
TCGTATCCCGAGCTTGACGCCTTTAGCACCAACATTTTGGCCGCGATGGGTGCCTCTGCAGACAACATCGAATAC
GTGTATCCTTGCTCACCGATACAAGAGGGCATGCTACTCAGCCAGGCCAAGGTTTCGTCGCACTATCTCAACAGG
GCGTTCTGGGTGCTAAGATCGCGAGGAAATGGCCCCGTGCGCGAAGAACAGCTCAGGACCGCTTGGCTGCGCGTA
GTGCAGAAGCACCCTCTCCTTCGCACCGTTATTTTCCGGAGTCCTCGTGACGACGGCCATCATGACCAGCTGGTG
CTCAGGGAACCTCCGGACGGAATGTGTGTCGTGCTGCCCGCCTGCGAGGATCCGTTGCAGCGGCTCAAGGATCAT
CAATTCGACACACCCGAACTGAGTCCGCCTCACCGGTTTGCCATTTGCTCGTCACACCATGGCGATGTGATGTGC
CTGCTCGAGATCAGCCACGCATTAGTCGACGGCTTCTCCAGACAGCTGCTCCTGCGTGATCTGTGCTCCGCATAC
GATGGCCCGCTCGTCAGAAATCATGCAGTGGGGACATATCGAGACTACGTTGAATATCTTGAGTCTATCCCCCGG
GAAGACGCCATCATCTTTTGGCAGAGCTACCTCAAGTCGGTGCAGCCATGCAATCTTCCGCCTACGCCACCTCGT
CAACCCTTTAACGACACCAAGCGGGTACACAACTTCAAACTATCCTCTGACCATGCGCTCCATCACTTTTGTGCT
CAACAAGAGCTCACACTGGGCAACGTGCTGCAGCTGGCGTGGGCCTTGGTCCTTCGGTTATATGTTGGTGCTGAA
TCCGTGTGCTTCGGGTACATGTCTGCAGGCAGAGATGTCCCCGTGCCCGGCGTCGACGAAATCGTCGGCCCGCTT
ATCAACATCCTGATTTTCCGTCTTCCCATTGACGGCGGGGAGTCTCTACTCGACTTGCTACGACAGAATCAGGCG
GACTTTGTTCAGTGCTTGAAATACCAGCATCTTCTCACGGCGGATAAGATGAAGGCAGCCGAAAAGTCGGATTCC
AAGCTCTTCAACACCATCATGTCTGTCCAGAGAGAGATCGAGCCACGCCGAGATGATTCGAGCGTGGAATTCGGG
GAACTGGGTGGGGAGGACCCGACCGAGGTGAGTCTATGTTCCGATTCTGTACGAAGCGCGCTAACCGGACGTTTC
CAGTACGATGTCATCCTCAATATCGGTCTCCTGGAACAGGAAGTGAACGTGTCGCTTCAGTACCGCTTGGCTTTC
ATCTCCGACGAGCAGATCGAGAACATGGCAGATGCGTTCCAGCAAGCCTTGCTTGACATCGTGGCAGAGCCGTCA
CAGACAGCCAGAACCATGAGTCTCTTTGGCGCGCTAAGCTATCAACGCGTGACAGAGTACAACAGGCATGAGTTA
GTACCTGTGAATGACTTTATCGACGAGCTCATCGCGAGTCGCTGCCGCGCCCAACCTTTAGCCCTTGCGATTGAC
GCCTGCGACGGGAAGATAACGTATGGTGAACTCGACGACTATTCCTCGCTTGTCGCTGCCGAATTGGCTCAACGT
GACATCGGCCCAAACCGATTCGTTGCTCTATGCTTCGAAAAGTCTCTTTGGACCACTGTGGCTCTACTGGGCGTG
CTCAAAGCCGGCGCGGCTTTCATTCTTCTGGATCCCTCTCACCCTCAGGAAAGGCTTCAGAGCATCTGCCGGGAC
GCCATCGTTGCAATAGTCTTGACATCGAACAGCAACCGCAGCCTGGCCGCTCAGCTGGCATCTGAGACTCTGGAC
GTTGGAAAGCAGATTGTAAGCTGGAAGATGAAGGCCACGCCTCCAAATCGCGGCAGCCGGGACCCTAGCGATGTG
GCATATCTCATCTTCACCTCGGGCTCTACTGGGAAGCCCAAAGGGGTCATGGTTCAACACGATGGACTGGCTACG
AGCGCCTTATCACACGGCTCTGCCTTCTTGATGAATACGAGCTCGCGAGTGCTTCAATTCGCTTCCTATGCATTT
GACGCATCCATCGTGGATCAGATTACGACGCTCATTTTCGGAGGCTGCATCTGCATTCCTTCGGACGTCCAGAGA
CAAGATATTGCCAAGTCAGCAGCCGCCTATGAGGCGAACTGGGTTAGTTTGACGCCGTCAGTTGCTAGAGCACTT
GATCCCGCCGACTTTCAGACTCTTCAGACCCTCGTCTGCGGCGGTGAGTCTTTCAATGACAAGGTGATGAGCGCG
TGGTTCCCCCACGTAAACTTCTTCACAGCCTACGGGCCTTCAGAGTGCGCCATCATCTGTTCTGGGAACCTAATT
ACCAGCGAGTTTGATGATCTCCGCAACCTTGGACGCTTCTTTGCCAGCCATGCTTGGGTTGTGAGTCCTGATGAT
CCCAGCATCCTGCTTCCAGTCGGCGCGGTAGGAGAACTAGTCGTCCAAGGCCACATTGTCGGTCGCGGCTACCTT
CAGGACCCGGATAAAACCGCATACGCGTTCATTGAACCACCGATGTGGTTGTCCAAATTCCGCAACGGCTCCGGG
GGCCGTCTCTATAGGACTGGCGACATGGTGCGTTACGTCAACGGCGAGGTTCAGTTTGTGGGTCGCAAAGACTCG
CAGGTCAAGCTTCGGGGTCATCGTATCGAACTGGGTGAGGTCGAGATTCATGTTCTGGCTTCCTTTGCCGGCGCT
GTCCATGCCCTAGTAGAAGTCGTCACGCCAGTGGATGGGGGCAAAGCACTTCTCGTCGCCTTCATACAAACGACG
AATGAGTCCCCAGAGACGAACCACGACAGCCTCTTCGATAAGCCAAGCAAGCCTTTTGCTCTGAAGGCGCAGTCA
GCCGAAACTCAGATGACAAAGTCCCTGCCCATCTATATGATCCCTGTTCTCTTTCTGCCTCTACGATGGATGCCC
CTGACTGGAACAGGCAAGGCGGACCGCAACAGGCTTCGCTCAGCGGCCGCACGTCTTAGTGCCCAAGAGCTGGAG
CAGTATGCCTTTTCCACGAGGCCTAATGTGATGCCATCGACCAAGGACGAGGCTTTACTCCAAAAAGTATGGGCA
CGTGTCTTGAACAAGGACCTTGCGTCTGTTGGAATTCATCACAACTTCTTCAGACTTGGCGGCGACTCCATCAGT
GCGATGCAAGTCACGTCGCGGTGCGCCGCCGCAGGTCTCCGCGTCACTGTAGCCGACATTTTCCGGCACAAGACG
ATTGCGCAACTCGCCGCCGGCATGGAAAAGTCATCGGCTTTGGATCTGCCATCAGAAAAGGTAGATTGCCCGTTT
GAACTGTCTCCAATCCAGAAGCTGGTATTCCGGGTCGCTCCTCTAGGAAAACACCATTTCAATATGGGGTTTTTC
CTTCGAATAGCACACATGATTCCCTCCGACCATCTTGATGATGCGCTTCATCAACTTGTCCAACAGCACTCCATG
CTCCGCGCCCGATTCTCCCAATCGCAGGACGGTCATTGGGTGCAATCCATCTCTGCAGACGCGCCTGGCAGTTAT
CGCTTTCGTGCCTGTGACATTGATACGATGGACCAGGCTGGAGAAATCATCTCCGAGAGCGAACTCGCCGTCGAT
ATTCAGCACGGCCCCATACTAGCAGTCGATTTGATCAATGTTGGTAGCCAAAACCAATTCCTCTTTATTGTCGCC
CACCATCTCGTGACGGACCTGGTTTCTTGGCGAATCTTATTAGCAGATCTCGAGGACTATCTCACCAGGGGTTCC
ATCTCCAAGCCATCTCTTCCATTTCAAACATGGTGCCATCTACAGGCAGAGTACGCAGCCAGACATCTCGACCCG
GAGCATGCAAGGCTTGACAATGGAGCCGCACCACCTCCGGCTGATTACTGGGGAATCGCTAGACAGTCGAACTCG
GTCAAGGATACTGCCCAGACAGCTTTTACCATTGACCAAGCAACGACCATCGGCTTGTTCGGGGCTGCTAATGAG
GCCTTCCGAACACGACCCGTCGAGCTCTTCCAAGCGGCTCTCCTCTTTTCCTTCGCCCAAGTTTTTAGAGATCGC
TCGGCTCCGGTTTTGTGGAATGAGGGACACGGACGTGAACCGTGGACACGGCAGCTCGACCTCAGTAGAACCGTT
GGGTGGTTCACCACGCTGTGGCCGGTGGCCGTCGAAGCCGACGGACTCAGTCTCTTTGATGTCGTTCGCAGGACA
AAGGACAAGTGCCGCAGCAGCCCAGACAACGGATGGGCACACTTTACCTCTTCTCTGCACCACAACGCAAGGCAC
ATCGACGTCCGAGAAATCACTTTCAACTTTATAGGGCGCTTCCAGCAACTTGAACGCGAAGAGTCACTTTTCATG
GCTCACCCAAGGCCCCCGTCCCGCATATCGGATATTTCCGAAGAATTGGGTCGTCTTTCAGTGATTGATGTCACG
GCAGACGTTAGAGACGACTGCCTTGGTTTCCAGTTTCACTACAACAAGTACGCCGCTGACAATCGGCCCATTCTG
GATTGGATTATCGAGTGCAAACGGACACTCGTCAGAATGGCCGGGGAGCTACCAGAGCGGCCGGCGGAACACACG
CTCAAGGATTTTCCCTTGTTGCCCTTTACGTACGACAGTCTTGACAGCTTCTTGGTTCACACTCTACCCAGCTAT
GGCGTCTCGCCGGCCAATGTCGAGGACGCATACCCGTGCTCTCCGATTCAGCGTGGGATCCTTCTCAGTTACGCC
AAGCAGGCGCGTCACTACCAGACCTTTCTTGTCTTCAAGGTTAAGCCCCAGAATGGTTCCGAGGCCGTAAGCCTT
GACCGCGTCGTTGCGTCTTGGCAGAGAATTGTGTCGCGCCATGCCATCTTCAGGACAGTCTTTGTCGAGAGCATC
TCGCAGGACAACTGGCTTGATCAAGTCGTACTCAAAAAGGTGTCGGCTCACGTCAACATACTAAGTCCTGATGAA
GAAGCAAGGATGATGACAGCGCTCTCAGATGATCGGCAGCTCGCTGTCACTCGAGGACAACTCCCGTATCGGATG
ACGATGGGCCAAACAGTGACAGGAGACGTCTTGTGTGGCCTTGAAATGAGCCATTCGCTCTTTGATGGCGCATCC
AGGCAGAATCTGCTTGCCGAGCTCGCCTTGGCTTACGATGGCCCTCTTTCCTGTGTCCCTGGGCCGGCTTACCGT
GACTACATAGCTTACCTCGAAAGCCGACCGGTCAAGTCGCATCAGCAGTACTGGGCCAAGTATCTTGAAGGCGTC
GTACCTTGCCAAATCCCAGCTACCCCGGATATAAGGATCAACTCTGCAGAGGATACACTGGGGTCTATCCACATT
CACCTCGGGGACATGTCGGCTCTCCGGCAGTTCTGCCAGTCCAATGAGTTGACACTATCCAACGTCTTTCAAGTT
GTCTGGGGTGTAGTTTTGAGGGCATACACCAATTCGGATGACGTTTGCTTCGGATATCTCTCTTCCGGCCGTGAC
GTGCCGGTTCCACAGGCTCATGAGATGATAGGCCCCCTCATTAACATGCTGGTCTGCCGCATGCAGATTGACGAC
TCGCAATCCTTAAGGGAAACACTCGAGGCGGGCCAGGACTCGTTCGCCGAGAGTCTCAAGCACCAGCACTATCCC
TTGGCCGAGATGCTTCGGGCCGCCAACATTTCAGGCGGCAGGTCTCTCTTTAACACGGTCATGTCTCTCCAAACC
ATGGGCCGTACCAAGTCCAACGATACGTCGTCTGTGCGCGTCGATGTGGTTGGGGGTGAAGATGCCTCAGAGGTA
AGGGGCCTCGTACTCACTATTTACCCTGCTGACTGACATCTACAGTACAACATGACCATCCACGTCCTGGTTGAA
GTCGATGGCATAGACATCTTGCTGGAATACTGGCGATCATCACTTTCGGACGACCAGGCCAACCAAGTAGCCGAG
ACGCTGCGTCAAGTTGTCCTTCAAGTGGTTGACAAGGCGGACAATTCCATTGGAGACATCGAGCTGGTGAGCAAG
ACGAGTCTCGACACCTTGACCCAATGGAGTGGGACATTGCCGCCACCAGAATATACCCTTGTCCATGATCTCATC
CATGAACAGTGCCTCGCCCAGCCAGAAGCACCTGCTGTAGATGCTTGGGACGGCACTTTTACGTATCGCGAGGTC
GACGAGCTAAGCTCGAAGCTGGCGAACCACCTGGCGCACTTCAGGCTCGCCCCCGACTCCTTTATCCCTATTTGC
TTCGAAAAGTCTCGGTGGACGACGGTTGCCATGATGGCAGTCATGAAGACAGGCTGCGCCTTTATTCCTCTCGAT
CCTTCACAGCCCGTACAGCGCCTGCAAGACATTTGCCAGGGTGCGCAGGTTTCTGCGCTTGTCGCCTCTAAGGAG
CAGGCTCGCATAGCAGCATGTCTCGCCAAGCATGTGGTAACCGTCGGTGATGATGACCAAGACTGGAGGGAGACT
GATCCGGGGCATCAACTCGAATCATTTTCACCCAGAAATCTCCTCTACGCCATCTTCACGTCTGGGTCCACTGGC
AAGCCCAAGGGGGTAATGATTGAGCACTGCGCCTTTTCTTCAAGTGCGAAAGCGCATAGTAAGGCGCTGAATATC
ACCAAGGACTCTCGGGTGCTGCAATTTGCATCCTATGCCTTTGACGCGAGCGTGAGCGAGACGCTGACTACGCTA
CTGAAGGGCGGGTGTGTCTGTGTCCCTTCCGATGAGGAACGGAAGATTTCCCTCGCTGCGGTCGTTTCCAGGACG
CAGGCCAACTGGATGTTCATGACTCCTGCCGTTGCCAGAGTCTTGAACCCTGATGACTTTCCGTCTATCAAGACG
ATGCTTTGCGGTGGGGAAGTTGTCTCCGAGACGGAGCTGATGCTCTGGAGGGATGCTGTCGATCTGCGCCTCGTC
TATGGGCCAACCGAATGCGCCGTCTATTGCAGTGCCACCAACCAGGTTACGGCCGAGACGAGTGCCAGAAACTTG
GGCAGGCCTTTCGGATGCCGGTCTTGGGTCGTCAAGCCGCACAACCATCAGAAACCGGTCCCCATCGGCGCTGTG
GGTGAGCTGCTCATCGAAGGTCCCATTGTCTCTCGGGGATATCTCGACGACTCTGAAAGGACAGCCAGCGTCTTC
ATCGACCAGCCCGAGTTTCTCAAAACCCTTGGAGACACGCCATCTGCCATTTACAAGACTGGAGATCTTGTGAAG
TACAATGCCGACGGATCTCTGGAGTACGTATCAAGAAAGGATACCCAAGTCAAGCTCCGTGGTCAGCGCATCGAA
CTAGGCGAAGTCGAGCAACGGGCGCGGCAGTGCTTCCCTCGTTCGACAGACGTGGTTGTCGAACTCGTCGAGTCC
ATGGGCCCCTCGCGTCACCCGGCCCTGGTTGCTCTCATTCATACAGCAGCCGAGTTGCCGACCAAGGGTCAGGAC
ATACTCGCTGAGCCGTCGTCTTCGTTTCGGCAGGAGGCACAAGCAGCCGAGACAGCACTCACCGAAATGCTGCCC
AGTTACATGGTCCCCTCGTTCTATCTCCCCGTACACCGTATGCCACTCAGCAACAACGGCAAGGTTGACCGCCGG
CTCCTTCGACAGCTTGCCTCGACCCTTTCCGATGGCCAAGTCACGGCCTACAGTACCTCTCTGGGCGGCTCCAAA
CTCCAGCCGACGAGCGATGTTGAGCGACGACTGCGGGCCGTCTGGGCGCGGATCTTGAACCTAGAACCCGAGGCA
ATCGGCATTGACGACAGCTTCTTCCGCATTGGAGGTGACTCCATCAGCGCTATGCAGGTGGTGACGCAGTGCGCC
AACGAGCGACTTCAGCTTACGATGGCCGACTTCTTCCGATACAAGACCATCTCGGCCATCAGCCAGCAAACGACG
TGCTCGGTCGCACCGACTCAAGATATAGAGGTCCAGTACGAAAGCCCCTTTGACCTCTCTCCGATTCAGCAAATG
TTCTTCGAGACAGCTCCCGACGGTGTCAAGTACTTCAACCAGAGCTTCTTCCTCCGCCTCAACACGGACATCGAC
TCAGCTGTCCTACGCGATGCCATGACTCAACTCGTGACTCGCCATCACATGTTACGTGCTCGATTCAGGAAGACA
GTCAACGACACATCGAGAATTGGCGGATGCATGTGGCAACAGCTCATCAGTGATACAGTTGATGGTGCTTTTAGG
TATCAAGAGCATCAGGTTGCCCACCTGGAAGAGTCTCGCCTCATTCTCGTGACGGCCCAAACATTGCTAGACATG
CAGCATGGTCCTGTCTTTTCCGCTGACCTCGTTAATGTTGCCTCGGGCGGACAGTATCTCTTCATGGTGGCCCAC
CATCTGGTCGTCGACCTGGTCTCGTGGAGGATTATCATCCGTGACCTCGAGGATCTGCTCAAGACGAGGTCTATT
GTCTCTCCGCCCTCGATTTCTTTCCAGGCCTGGTGTCGACTTCAATCCGATTACGCCCTCGAGCATCTCACCCCA
GACTGTCCGCTTGCCGTACAAGTGCCTGCACCGATGCTAGACTACTGGGGTCTGTCGACTGGAAACAATCTTGTC
AGCGACATCGTCGAAAAGGAGCTTGTCCTTGGTGAGCAGGTGACACGCACTCTGCTCGGCACGGCCAACGATGCC
TTTCAGTCCAGGCCGGTCGAACTATTGCAAGCTGCCTTGATACACTCCTTTGCTTTGACTTTCCAGGACCGTCCT
CTACCAGCCATCTTTTCAGAAGGCCATGGCCGCGAGGCATGGGATTCAAGCATCAACTTGAATAGCACGGTGGGC
TGGTTCACCACGCTGTCGCCCACCGTTATCGAATCAACAGATTTGCTCGAGGCCGTTCGTCAGACCAAGGATCAG
CGCCGAAGGCTTCGTGACAACGGATGGGCGTACTTTACGTCGCGCTACTTGGGTTCTGCAGACCGGCTTTCCCTC
AAGACGCCTCTTGAAATCGTCTTCAACTTTACTGGCTCGTATCAGCAACTAGAGCGGTCTGATGCGTTATTCTCG
CTTGCCACTGAATTTCGCCCCAGCGTGCCCGACATTTCTCAAGACTCACCGCGTTTCGCCCTCTTTGACGTCTCT
GCTACCGTTTCCAACAACCGCCTCAGGCTTAGCTTTTTCTACAATCATCGTGCCGCTGACGTGCGCCCTGTTGAC
CTCTGGATTTCCAACTACGCAAAGACACTCGAGCGCCTTTCCTCCACGCTACCTTCTCAGCCGCTTACCTACACT
CTCGCCGATTTTCCTCTACTGCGCTGCAGCTATGCGGCTCTTGATAGGTTCGTTGAGGAGACGATTCCAAGGTGC
CAACTTTCCATGGACCAGGTGGAAGATGTCTATCCTTGCTCGCCTATTCAAAATGGGATGCTTCTGAGTCAAACG
AGATCAACCGCGGTTTACTATAATCGCTTTCTATTTAGGGTCAAGCCAAATTCGGGGACGGGCAACGTCTGCGAG
AAACGGTTTGCTCGTGCTTGGCGTCGAGTCGTTGCCAGGCATCCCATTCTGCGTACGTTTTTCATACCCAGTCTG
GGCCAAGGCAGCTTCATGGACCAGGTTGTACTACAAGAAGCGCGGGATGACATTGTCACCATGTTACCCATTGCC
AAAGACCCGTTGACGATACTCCAGAACCACTCTTCCGGCCTGCAGGCCCAAGGCGTCGTGCCTCATCATCTCACA
ACCTGCTGCTCACCGAACAGTGAACTGCTTGTTCTGCTGGAGATAGACCATTCCCTGCTAGACGGCACTTCGTTG
CAGATTCTGGTCCGAGACCTGCAGAGTGCCTACGACGACTCACTTCCGGCTCAAGCTGCAATGCCCTACAAAGAC
TACATCGCCTACGTCCAAAGCATCCCGACGGAGGAGGCCAAGCAATATTGGATGCGGTACTTGGAGGGAAGCAAC
CCTTGCCTGTTTCCCTCCATGTCGACGAATTCGGAATATCCCAAATGGCAATCCGCTGTTGCTCAGCTGGGGGCG
AGTTCTGATCTAACAAGGTTCTGCGAGGCCAACCACTTGACGCTGTCCAATGTGGTCCAAGTGGCCTGGGGACTG
GTCCTCCGGGCCTTTACAGGCTCAGACGATGTCTGCTTTGGCTATCTCACCTCGGGCCGTGATATTCCTCTCCCG
GGCGTCGAGGAGGCACTCGGGCCACTGATCAACATGCTCGTGTGTCGGATCGACTTCTCTAACGGCTCAACAATG
GCAGATCTGCTTCAACGCGCGCAGGAGGACCATGTCCAGAACAGCAGGCATCAGCATTTGTCTCTGGCCGAGATC
AAGGGCTCGCTTCAGCTGCCAGACATTCCGCTATTCAACACCATTGTCTCGCTACAACGAAGTGGAATGGTCCGG
GCGGTAGAGAGCAAAAGGTCCGTGGCAATTGAACCGGTCCAAGGAAAGGACCCAACCGAGGTATGTGCGCGTTTA
TCCTAGACCGATAGAATGGCGTCGATAACAGAGATGTATTAGTACGATATGACGGTCAACGTGTGGGTTCATGAA
GACTCCATCAAGCTTGTTCTCAACTACTGGACATCATTCACGACCGCAGGCCAAGCGGCTACTGTGTTGGATACC
TTGTCGCAGGCCATCTCGGAAATCAGGCTCAAGGTTTCCCAACGCGCAGCCGATATGAATCTCTTGGGCCCTCGA
AGCAGACAACAGGTTTGGCAGTGGAATCAACGTGTGCCGGCACGCATCGACCGCTGCGCTCACGATCTCATCAGG
GAGCGCAACCTGGAGCGAGCCGAAGAGCCAGCAGTCTGTGCCTGGAACGGTGACTTTTCCCATGGTGAGCTGGAC
CAGAAAGCGTCCCAAGTAGCGGCCCATCTTGTGCGTGAGCACGGCGTGGAACCCGGCGTCTTTGTCCCTGTCTAC
TTTGAAAAATCTAGATGGACTATAGTAGCCATTCTCGCCATTCTCAAATCCGGAGGCGCCTTCGTCCTCATGGAT
CCCTCACATCCTGCTCAACGCTTGAGCGAAATTTGTCGAGATGTTGGTGCCGCCATCGTCGTCACATCGGAATCT
AAAGCAACCGATGCTGCCGAGCTGGGCCCTCAAGTTATTGTTATTGGCGACGGGGAATTTGCCTGGAAAGAGGCA
GAGCCATTGAATGAGTTGAGAGCAAGGCCGAGCGACCCCATTTATGCCGTCTTCACGTCAGGCTCAACTGGCAAG
CCCAAGGGGGCTATCATGACACACGCGGCATGGTGTACGAGTGCAGAGGCTAACCGTATCGGACTGTTTGTGGAG
AGTCGGTCGCGCGTTCTACAGTTTGCGTCGTACGCGTTCGACATCAGCATAGCCGATATGCTTCTAACCCTCCTG
GCAGGGGGCTGCGTTTGCGTGCCTTCGGACGAGGACCGCCAGTCTGACTTGATGGGCGCCATCAACAATCTCGAA
GCGAATTGGGCTTGCTTGACTCCTTCTATAACCCGAATTATTGAGCCGGGTATGGTTCCGTCAGTCCACACCCTG
GTCCTCTGCGGAGAGGCAGTGGCACCAGGAGACATCGCCAAGTGGAAGCCCCACGTCCACCTCCTGAACCTGTAT
GGACCAGCTGAGTGTGCCATCTTGACGACGCTCAACCGATTCGTACATGACGAAAAAGATGCCAACAACGTCGGC
TATCCTACGAGTGCCGTGTGTTGGGTTGTCGATCCCGATGACTATGAAAAGCTGGTTCCCGTCGGCCAGGTCGGC
GAGCTCGTCGTCGAAGGTCCTATTGTCGGCCGCGAGTACATTGGCAATCCATCACAATCAGCAGCATCCTTTTTG
CCCTGTCCTCTGTGGTTGCGACAGTTCCGGCCGTCGGCCGCGGGACCGATCTATAGGACTGGAGATCTGGTTCAG
TACGTGGAAGACGGATCCCTTCGCAGTATTGGCCGCAAAGACACGCAGGTCAAGGTCCGCGGCCAGCGCGTCGAA
CTGGGTGAGGTCGAGCACCACTTGCGGCAGTCTTTCCCTGATGCGCAGTATACGGTTGCAGAGGTCATCCAAACG
GGCGGCCGGCCTTCACTGGCCGCCTTTATCTACACCGGCGGACCAGAAGCAGACGAGTCAGACGACGACAACATC
TTTCGGGCCCCTGACGACCATTTCAACATGGCAGCAAGCAAGGCCGTGTCCCATCTTCAGCGTGTCCTGCCCGTC
TTCATGGTGCCTACGAGCTTCATCGCCTTGGCTCGAGCGCCGCTGACGAAGACGGGCAAGATGGATCGTCGAACC
CTGCGAGCCGCTGCCGCCAACCTGACACGGGAGCGTTTTGCCCAGACCAATCTCATCCGGAAGAGAGCTCCCCGG
ACGCAGCGAGAGGGCCAACTGCGAAGTCTGTGTGCCGACGTGCTTGGGCTGCCTCCGAGTGACGTGGGCATCGAC
GATCATTTCTTCCGCCTGGGCGGCGATTCGATCCTAGGCATGGCGCTCATCCACAAGGCCCGCGAAGCTGGCTTG
GCCATTACCATGGCCGACATCTTCACCAATCCCAAGGTGTGCGATCTGGCTGCGGCGTCGACGCAAGCGACGCCA
TCTATAAGCTCTTCCATCTCGCCATTTGCCTTAGTCGATGACGCGGATACCATGGTTCAACTGGCATCGGCCCAG
TGTGGCATATCTGCCACCCAGATTGATGACATTTACCCCTGCACGCCGCTCCAGGAAGGCCTCGTCGCCTTATCC
GCCAAGCGACCGGGGCACTACATTGCGACGTTCGAGTTTACGCTGGCCGAATCAGTCGACGTCAAGAGATTCATC
GCTGCCTGGGACTCGGTGGTCGTCGCCAACCCCATCCTACGCACACGCGTCATCCAGTCAGACTCGGGCTTCTTG
CAAGCCGTCGTCAAGGATGCTGTTCCGTGGCAGTCGTTTGATGGTCCCGAGTCCTGTCGGAAGCACGTGAACGCC
ACGAGTATGGGACTGGGCGACCCCCTGGTGCAGTTCGCCCTGGTCGAGTCTAGGGCATTTCACCTGACGCTCCAT
CATGCGCTGTACGACGGAGCCTCGCTGCCCAAACTCTGGAGCCAAGCCGAGGCTGCATACAAAGGCGTGTCTCTT
CCTCCGAGGCCCTTCAACAGCTTCATCGGACACGTGCTCGCCGCTCGGGGCGGCGACTTTTGGCGGTCCGAGTTT
GCGGGCTTCAACGGCCCCGTCTTCCCGACCCTTCCTCGGTCACGGTATATCCCGGATCCGGCTGCAGCGCTGGAA
CACAGAATCGCAGAGCTGGAGCTTGAGTCCATCGAGTATACCATTTCGACGGCCATCCGGCTAGCCTGGGCCGTC
GTCTTATCCTGCCACGCCGACTCAGACGATATCCTCTACGGCTTGACCGTCAATGGCCGCAGCGCTCCCCTTGAG
GGCATCGAAGATATCACGGGGCCGACTTTTGCCACATTCCCCGTACGCACTCGCGTCAACCAAAGCGATACCGTC
CAGACGGCCCTGGCAGCCATTCACCAACAGACGACTGCGGCCATGCCCTTCCAGCAGTTTGGCATGCAAAACATG
CGTCAGCTTAGTCCCGAGGCCGCCGCAGCATGCAGCTTCCAGTGTCACGTTACCATTCAGCCATCGGGGGAGTAT
CCTCGGCATGGGCTTCTCGCTGACGTCCGGACCAAGCACGAGGACTATGGCAAGTTTGCCAATTACGCTTTTGTC
CCGATATGCCATCTCCCTGCCAAAGACGAGAGTGAGCTCCTCGTCACAGTCAGTCACGATGCCAACATTGTGCAC
CCGCTCCAGGCAAGAAGAATGGTTCAACAGTTTGAGCACGTCCTTCGCCAGCTGGTTCGGCAACGATGCCAGTCT
CTCTGTCTAGGCCAACTGGATCTGATCAGTCCGCAAGACCGACAACAACTGCTGGAATGGAACCGGGCTCTGGAA
AAGCGAGGAGAAAGAGAGGGGGGAAGGGGACAGTGCCTCCATGAAATGGTCCTGAGCTACGCCTCTAGCTTGCCC
AAGGCTCCCGCAATCTCCGCGTGGGACGGCGACATGACATTCAGTCAACTTGACGCTGCCACGGCCACGCTTGCT
CGGCAATTTCAAAGTCTCGGAATCCAAGCTGGAGACTTTGTCGCGTTGCTGTTTGATAGATGCCGGTGGCTTGTT
ATCACCATGATTGCCCTTCACCGAATCGGAGCTGTCTGTGTCAACATTGATCCGACTCTTCCGCGAGAGCACATT
CAACAACTTCTCAACCTCTCCCGAGCCTCGTTCGTGTTGACGGGTCCTCAAGACCTGGCCGAGATGGGCTTCGAC
AACACCACGGTTGCCACGGTCCCCATTGTCGGGGCGCAGCCTCAACCACACGAATTCTCCGCTCCCAATGTCGAC
TGCCACGATGCCGCCTTCGTCACCTTTGCATGGGGAAGCAAAGGAGAGCCCGCGGGCACCATCACGGAGCACGCC
AACTTGGCGACCTGGATCCGGGACAACAGTCACGAGGCCCGCCTGAATCCCGGCACCCGCGGCCTACACTTTGCT
CCGTACGCCTCTGAAGCCAGCATTTACGAAATCTTTGCTGTTCTAGCCAACGGGGGCTGCATCTGCATTCCGTCC
GAGTCGGACGACATTGTGTCGTTTATCAACAAGCATGGCATAAACTGGGCCCTCTTCACACCCTCGTTTCTGTCT
CGGATGAGCCCGAATGCTATCCCTGGCGTCGGCACCATCCTTGTCAGCGGAGAGGCAACAGCCACGCAGAATATC
GACGGGTGGGCGTCTCATGTCAATCTGGTTGCTACTAGATGTGGGCCGACAAAGACAACGCTTGCACCATCAGTT
GAGAAGCAGGGCTCCCTTGTGCGCGTGACGGCCGGCGTTGGATGGATCGTCGTGCCGTCGGAACCGTCTCGCCTC
GTCCCAATCGGTGCCCCTGGCGAACTGGTCGTCGAAGGCCAATCACGGGATTCCGAAAACACAAATCCTCCCTGG
CTCGGACCGTTCCGAGAAGGCAATACGTCGAGTTCAAGACTCTATCGAACTGGTCATCTCGTCCAGTACAGCTCT
GACGGGGCCCTTCTCTTCCTCGGCCGCCGAGACGCCCAAATCAAGCTCCGAGGCCAGCGTATCGAGTTGGGCGAG
GTGGAGCACCAAGTGCGGCGTGCGTTCCCCGGAATCTTGGACGTCGTGGCCGAAATCATCTCTCCGCATGATGGA
GGAGGCTCTGCTTTCCTCGTGGCCTTTGTTGCCAGCGGCGTCGACTCCATGTCCGAGAGCCTATTCGAAACTTGC
AACGCAGAGTTCTTGGCCCAGGCCGAGGCAGCATCTCGCAGCATGGGGAAAGTCGTGCCCGATCACATGGTTCCG
GCCATCTTCGTGCGGCTTTCGGCCATGCCTCGTGACAAGCATGGCAAGGCAGACCGTGGAAGGCTCCTGATGGAG
GCCTCCAAGCTTTCCCAGCATCAACTGCAGGCTTTGTTCCGCCACGTCGACGTCGACATAAAGCGGCGGAAGCCC
GAAACGGCACAGGAGATACTGCTCCAGACCTTATGGGCCCAGGTGCTTACGATGGCTCCCGACGATATCGGCCTA
GACGATGACTTCTTCAATCTCCGTGGGGACTCCATCTCAGCCATGAAACTTGCGGGCCTTGCTCGCCGCCACGGA
AAACTCCTGCCCGTCTCGCGCATCTTCAAATTCCCAGTCCTTTCTGAGCAGGCCGCCATGATGGAGACGTCGAAT
GTCCATGACCCAGAAGACGAGTATAGACCCGGATCGCTGCTGGGCATCACTGACGTTTCCGCTTTCTTCGACGAC
CAGCTTGGGGCACAGGCTCGCGCGTACAGAGGACAAGACGTCGAGGATGTCTTGCCCACGACTGAGACTCAAGCG
TCTTTTCTCAGAAACAAGAACCTCACTCATACGCGTCTGCACTTGAGTACCGAGATTGACGCTGACCGCCTCGAC
GCGGCTTGTCGAGCCCTTGTCCGCAAGCACGCCATACTACGAACTGTCTTCGTCGTCCACGACGACGGCATTCTC
CAAGTCGTCCTGCGAGATGTTCAGGTCCCACTGCTGCGACTGGAATGTAGCGAGGATCTCTGGCAATACTCGGAG
AAGCTGTACGAACAAGATGCATCCTCGCCAGTTCCATTCGGCTCCCTCCACTTCCAGCCGATACTGGTCTCAAGA
TCCGAGTCGGAGCACATGCTCATCCTCCGAATGACACACGCACAGTACGATGGAGGCTCGATGCCGATGCTCTCC
CAAGATTTGGCTCTGGCCTACGACGGTCACGAGCTGGCGGAGCGGCCCCCTTTCGCACACTTCCTGCGCTATCGT
CAAAGGCAGGACACGACACAGACGCGTGAATTCTGGAGAGCGCACCTGCTCGGCTCCGAAATGACGGACTACCGA
GTGCTCTGCAAAGCGCCGCCGGCCGTGAGCAAGGAGCATGAAAGCGTGGTGAAGCCACTCCGAGAGACGGCTCTT
CCGTCTCCTCCTCCAGGCGTCACCATGGCCTCGCTGGTCAAGGCAGCCTGGTCCGTGGTGCTGGCCAGGGCAGCC
GGCAAGACGGATATTGTGTTTGGCCACCTCATCAACGGCCGAGACGCGCTCCTGCAAGGCATCCATGACATATCG
GGCCCTTGCATCACCATGTCGCCCTTTAGGGTCGTGCTAGAGGAATCATGGACTTGGATGGATCTGCTCGGCCAC
GTTCAGGCGCAGTATCTCGAAAGCATGCCCTTCAGCCACTCCGACTTGGCCAAGATCCGGAGACATTGCACCGCG
TGGCCCGCAGACACCCACTTCGGCAGCGTCGTCACCCACCAAGACGCCAATATCGATCTGACGGGCTCCATCAAC
GGGTCGCCACCGTCCATCTGGCGCAACTTGAACCTAGGGATTCATTACGACTTTCACGTCGTCACCACCCCGGTC
GAGGATAGGCTGCTTGTGCAGTTTTCCGTGTCGAGTGCCAAGATCAACCAGGACGACGCGGATACTACGATTGAT
GAGTTTTGCCGCATCATGGCTGAGATTTCGGCCGATCCTACACGTCCTATACAGCTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail