Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|341
Gene name
Locationscaffold_108:2178..3597
Strand+
Gene length (bp)1419
Transcript length (bp)1293
Coding sequence length (bp)1290
Protein length (aa) 430

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07970 COPIIcoated_ERV Endoplasmic reticulum vesicle transporter 3.2E-88 141 412
PF13850 ERGIC_N Endoplasmic Reticulum-Golgi Intermediate Compartment (ERGIC) 2.1E-29 7 96

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q09895|YAI8_SCHPO Uncharacterized protein C24B11.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24B11.08c PE=3 SV=1 1 424 4.0E-117
sp|Q6NVS2|ERGI3_XENTR Endoplasmic reticulum-Golgi intermediate compartment protein 3 OS=Xenopus tropicalis GN=ergic3 PE=2 SV=1 1 424 1.0E-89
sp|P39727|ERV46_YEAST ER-derived vesicles protein ERV46 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERV46 PE=1 SV=2 4 421 2.0E-88
sp|Q803I2|ERGI3_DANRE Endoplasmic reticulum-Golgi intermediate compartment protein 3 OS=Danio rerio GN=ergic3 PE=2 SV=1 1 424 2.0E-88
sp|Q66KH2|ERGI3_XENLA Endoplasmic reticulum-Golgi intermediate compartment protein 3 OS=Xenopus laevis GN=ergic3 PE=2 SV=1 1 424 1.0E-86
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q09895|YAI8_SCHPO Uncharacterized protein C24B11.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24B11.08c PE=3 SV=1 1 424 4.0E-117
sp|Q6NVS2|ERGI3_XENTR Endoplasmic reticulum-Golgi intermediate compartment protein 3 OS=Xenopus tropicalis GN=ergic3 PE=2 SV=1 1 424 1.0E-89
sp|P39727|ERV46_YEAST ER-derived vesicles protein ERV46 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERV46 PE=1 SV=2 4 421 2.0E-88
sp|Q803I2|ERGI3_DANRE Endoplasmic reticulum-Golgi intermediate compartment protein 3 OS=Danio rerio GN=ergic3 PE=2 SV=1 1 424 2.0E-88
sp|Q66KH2|ERGI3_XENLA Endoplasmic reticulum-Golgi intermediate compartment protein 3 OS=Xenopus laevis GN=ergic3 PE=2 SV=1 1 424 1.0E-86
sp|Q9Y282|ERGI3_HUMAN Endoplasmic reticulum-Golgi intermediate compartment protein 3 OS=Homo sapiens GN=ERGIC3 PE=1 SV=1 1 424 2.0E-84
sp|Q5EAE0|ERGI3_BOVIN Endoplasmic reticulum-Golgi intermediate compartment protein 3 OS=Bos taurus GN=ERGIC3 PE=2 SV=1 1 424 3.0E-84
sp|Q5R8G3|ERGI3_PONAB Endoplasmic reticulum-Golgi intermediate compartment protein 3 OS=Pongo abelii GN=ERGIC3 PE=2 SV=1 1 424 8.0E-84
sp|Q9CQE7|ERGI3_MOUSE Endoplasmic reticulum-Golgi intermediate compartment protein 3 OS=Mus musculus GN=Ergic3 PE=1 SV=1 1 424 8.0E-83
sp|Q54DW2|ERGI3_DICDI Probable endoplasmic reticulum-Golgi intermediate compartment protein 3 OS=Dictyostelium discoideum GN=ergic3 PE=3 SV=1 5 424 2.0E-81
sp|Q4R8X1|ERGI3_MACFA Endoplasmic reticulum-Golgi intermediate compartment protein 3 OS=Macaca fascicularis GN=ERGIC3 PE=2 SV=1 1 424 7.0E-81
sp|Q7T2D4|ERGI2_DANRE Endoplasmic reticulum-Golgi intermediate compartment protein 2 OS=Danio rerio GN=ergic2 PE=2 SV=1 7 406 1.0E-25
sp|Q4R5C3|ERGI2_MACFA Endoplasmic reticulum-Golgi intermediate compartment protein 2 OS=Macaca fascicularis GN=ERGIC2 PE=2 SV=1 5 406 7.0E-25
sp|Q9CR89|ERGI2_MOUSE Endoplasmic reticulum-Golgi intermediate compartment protein 2 OS=Mus musculus GN=Ergic2 PE=1 SV=1 5 406 8.0E-24
sp|Q5EHU7|ERGI2_GECJA Endoplasmic reticulum-Golgi intermediate compartment protein 2 OS=Gecko japonicus GN=ERGIC2 PE=2 SV=1 5 406 2.0E-23
sp|Q96RQ1|ERGI2_HUMAN Endoplasmic reticulum-Golgi intermediate compartment protein 2 OS=Homo sapiens GN=ERGIC2 PE=1 SV=2 5 406 6.0E-23
sp|Q4V8Y6|ERGI1_DANRE Endoplasmic reticulum-Golgi intermediate compartment protein 1 OS=Danio rerio GN=ergic1 PE=2 SV=1 190 426 4.0E-20
sp|O94283|ERV41_SCHPO ER-derived vesicles protein 41 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erv41 PE=1 SV=1 1 413 2.0E-18
sp|Q9DC16|ERGI1_MOUSE Endoplasmic reticulum-Golgi intermediate compartment protein 1 OS=Mus musculus GN=Ergic1 PE=1 SV=1 190 426 3.0E-18
sp|Q969X5|ERGI1_HUMAN Endoplasmic reticulum-Golgi intermediate compartment protein 1 OS=Homo sapiens GN=ERGIC1 PE=1 SV=1 190 426 1.0E-17
sp|Q6NS19|ERGI1_XENLA Endoplasmic reticulum-Golgi intermediate compartment protein 1 OS=Xenopus laevis GN=ergic1 PE=2 SV=1 190 426 4.0E-16
sp|Q9T042|PDI54_ARATH Protein disulfide-isomerase 5-4 OS=Arabidopsis thaliana GN=PDIL5-4 PE=2 SV=1 198 425 1.0E-10
sp|Q69SA9|PDI54_ORYSJ Protein disulfide isomerase-like 5-4 OS=Oryza sativa subsp. japonica GN=PDIL5-4 PE=2 SV=1 190 424 3.0E-10
sp|Q9LJU2|PDI53_ARATH Protein disulfide-isomerase 5-3 OS=Arabidopsis thaliana GN=PDIL5-3 PE=2 SV=1 1 151 3.0E-08
sp|Q9DC16|ERGI1_MOUSE Endoplasmic reticulum-Golgi intermediate compartment protein 1 OS=Mus musculus GN=Ergic1 PE=1 SV=1 7 116 8.0E-08
sp|Q969X5|ERGI1_HUMAN Endoplasmic reticulum-Golgi intermediate compartment protein 1 OS=Homo sapiens GN=ERGIC1 PE=1 SV=1 7 116 8.0E-08
sp|Q9LJU2|PDI53_ARATH Protein disulfide-isomerase 5-3 OS=Arabidopsis thaliana GN=PDIL5-3 PE=2 SV=1 198 424 2.0E-07
sp|Q6NS19|ERGI1_XENLA Endoplasmic reticulum-Golgi intermediate compartment protein 1 OS=Xenopus laevis GN=ergic1 PE=2 SV=1 7 98 3.0E-07
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Endoplasmic reticulum|Golgi apparatus Signal peptide|Transmembrane domain 0.0823 0.1511 0.0632 0.2966 0.0596 0.0031 0.7478 0.4783 0.69 0.0051

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 25 47 22
2 389 411 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3935
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3864
Ophiocordyceps australis map64 (Brazil) OphauB2|2936
Ophiocordyceps camponoti-floridani Ophcf2|04424
Ophiocordyceps camponoti-rufipedis Ophun1|4383
Ophiocordyceps kimflemingae Ophio5|341 (this protein)
Ophiocordyceps subramaniannii Hirsu2|7835

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|341
MPAKSRFTRLDAFTKTVDEARIRTTSGGIVTIVSLLVVLFLSWGEWVEYRRVVIRPELVVDKGRGERMEIHLNFT
FPKMPCELLTLDVMDVSGEQQHGVAHGVSKVRLRPQSQGGGVIDVKSLALHDEKADHLDPKYCGECYGAAPLGTA
TKPGCCNTCDEVREAYAAQGWAFGRGEGVEQCEREHYAEKLDAQREEGCRIEGALQVNKVVGNFHLAPGRSFSNG
NIHVHDLKNYWDTPDGKKHDFTHTIHQLRFGPQLPDDVKQKLGGSGAMPWTNHHLNPLDGAQHDTTDSNLNYMYF
VKIVPTSYLPLGWEKKMQRLPGVMDGSADGSVETHQYSVTSHKRSLSGGNDAAEGHAERQHSKGGIPGVFFSYDI
SPMKVINREEQSKSFLGFLAGLCAIVGGTLTVAAAVDRGLFEGATRLKKMRSKDL
Coding >Ophio5|341
ATGCCGGCCAAGTCACGCTTCACGAGGCTCGATGCCTTTACAAAAACGGTCGACGAGGCGCGCATCCGGACCACA
AGCGGTGGCATCGTGACCATCGTGTCGCTACTGGTCGTCCTGTTCCTGTCGTGGGGAGAATGGGTCGAATATCGT
CGTGTGGTGATACGCCCCGAGCTAGTGGTGGACAAGGGCCGAGGCGAACGCATGGAGATTCATCTCAACTTTACC
TTTCCCAAGATGCCCTGTGAGCTCCTCACACTCGATGTCATGGACGTCTCGGGCGAGCAGCAGCACGGCGTCGCC
CATGGCGTCAGCAAGGTCCGACTGCGGCCCCAATCCCAAGGCGGCGGCGTCATCGACGTCAAGTCTCTGGCACTC
CACGACGAAAAGGCCGACCACCTCGACCCCAAGTACTGTGGCGAGTGCTACGGAGCGGCGCCACTGGGCACGGCG
ACGAAGCCCGGCTGCTGCAACACCTGCGACGAGGTCCGCGAGGCATATGCCGCCCAGGGCTGGGCATTTGGCAGG
GGCGAGGGCGTCGAGCAGTGCGAGCGCGAGCACTACGCTGAGAAGCTCGACGCGCAGAGAGAGGAGGGCTGCCGC
ATCGAGGGCGCCCTCCAGGTCAACAAGGTGGTTGGCAACTTTCACCTGGCACCCGGACGCAGCTTCAGCAATGGC
AACATTCATGTCCACGATCTCAAGAACTACTGGGACACGCCCGACGGAAAGAAGCACGACTTTACCCACACCATC
CATCAGCTGCGATTCGGCCCTCAGCTCCCGGACGACGTCAAGCAGAAGCTGGGAGGCTCCGGGGCGATGCCATGG
ACCAACCACCACCTCAATCCGCTGGATGGGGCCCAGCACGACACCACCGACTCGAACCTCAACTACATGTATTTC
GTCAAGATCGTCCCCACGTCATACCTGCCCCTTGGCTGGGAGAAGAAGATGCAGCGGCTGCCCGGCGTCATGGAC
GGCAGCGCCGACGGCAGCGTCGAGACACACCAGTACTCTGTCACGAGCCACAAGCGGAGCCTCAGCGGCGGTAAT
GACGCGGCCGAGGGCCACGCCGAGCGCCAGCACTCCAAGGGCGGCATACCGGGCGTGTTCTTCTCATATGACATT
TCTCCGATGAAAGTGATCAACCGCGAGGAGCAGTCCAAGTCCTTCCTCGGGTTCCTGGCAGGTCTTTGTGCCATT
GTCGGTGGCACGCTGACAGTGGCTGCCGCCGTGGACCGCGGGCTGTTTGAGGGTGCGACGCGATTGAAGAAGATG
CGATCGAAAGACCTG
Transcript >Ophio5|341
ATGCCGGCCAAGTCACGCTTCACGAGGCTCGATGCCTTTACAAAAACGGTCGACGAGGCGCGCATCCGGACCACA
AGCGGTGGCATCGTGACCATCGTGTCGCTACTGGTCGTCCTGTTCCTGTCGTGGGGAGAATGGGTCGAATATCGT
CGTGTGGTGATACGCCCCGAGCTAGTGGTGGACAAGGGCCGAGGCGAACGCATGGAGATTCATCTCAACTTTACC
TTTCCCAAGATGCCCTGTGAGCTCCTCACACTCGATGTCATGGACGTCTCGGGCGAGCAGCAGCACGGCGTCGCC
CATGGCGTCAGCAAGGTCCGACTGCGGCCCCAATCCCAAGGCGGCGGCGTCATCGACGTCAAGTCTCTGGCACTC
CACGACGAAAAGGCCGACCACCTCGACCCCAAGTACTGTGGCGAGTGCTACGGAGCGGCGCCACTGGGCACGGCG
ACGAAGCCCGGCTGCTGCAACACCTGCGACGAGGTCCGCGAGGCATATGCCGCCCAGGGCTGGGCATTTGGCAGG
GGCGAGGGCGTCGAGCAGTGCGAGCGCGAGCACTACGCTGAGAAGCTCGACGCGCAGAGAGAGGAGGGCTGCCGC
ATCGAGGGCGCCCTCCAGGTCAACAAGGTGGTTGGCAACTTTCACCTGGCACCCGGACGCAGCTTCAGCAATGGC
AACATTCATGTCCACGATCTCAAGAACTACTGGGACACGCCCGACGGAAAGAAGCACGACTTTACCCACACCATC
CATCAGCTGCGATTCGGCCCTCAGCTCCCGGACGACGTCAAGCAGAAGCTGGGAGGCTCCGGGGCGATGCCATGG
ACCAACCACCACCTCAATCCGCTGGATGGGGCCCAGCACGACACCACCGACTCGAACCTCAACTACATGTATTTC
GTCAAGATCGTCCCCACGTCATACCTGCCCCTTGGCTGGGAGAAGAAGATGCAGCGGCTGCCCGGCGTCATGGAC
GGCAGCGCCGACGGCAGCGTCGAGACACACCAGTACTCTGTCACGAGCCACAAGCGGAGCCTCAGCGGCGGTAAT
GACGCGGCCGAGGGCCACGCCGAGCGCCAGCACTCCAAGGGCGGCATACCGGGCGTGTTCTTCTCATATGACATT
TCTCCGATGAAAGTGATCAACCGCGAGGAGCAGTCCAAGTCCTTCCTCGGGTTCCTGGCAGGTCTTTGTGCCATT
GTCGGTGGCACGCTGACAGTGGCTGCCGCCGTGGACCGCGGGCTGTTTGAGGGTGCGACGCGATTGAAGAAGATG
CGATCGAAAGACCTGTGA
Gene >Ophio5|341
ATGCCGGCCAAGTCACGCTTCACGAGGCTCGATGCCTTTACAAAAACGGTCGACGAGGCGCGCATCCGGACCACA
AGCGGTGGCATCGTGACCATCGTGTCGCTACTGGTCGTCCTGTTCCTGTCGTGGGGAGAATGGGTCGAATATCGT
CGTGTGGTGATACGCCCCGAGCTAGTGGTGGACAAGGGCCGAGGTAGGCGCATGTGTCTAGGATGCGACCTGCCC
ACCGTTGGTTGACCGGGCCCTTCACAGGCGAACGCATGGAGATTCATCTCAACTTTACCTTTCCCAAGATGCCCT
GTGAGCTCCTCACACTCGATGTCATGGACGTCTCGGGCGAGCAGCAGCACGGCGTCGCCCATGGCGTCAGCAAGG
TCCGACTGCGGCCCCAATCCCAAGGCGGCGGCGTCATCGACGTCAAGTCTCTGGCACTCCACGACGAAAAGGCCG
ACCACCTCGACCCCAAGTACTGTGGCGAGTGCTACGGAGCGGCGCCACTGGGCACGGCGACGAAGCCCGGCTGCT
GCAACACCTGCGACGAGGTCCGCGAGGCATATGCCGCCCAGGGCTGGGCATTTGGCAGGGGCGAGGGCGTCGAGC
AGTGCGAGCGCGAGCACTACGCTGAGAAGCTCGACGCGCAGAGAGAGGAGGGCTGCCGCATCGAGGGCGCCCTCC
AGGTCAACAAGGTGGTTGGCAACTTTCACCTGGCACCCGGACGCAGCTTCAGCAATGGCAACATTCATGTCCACG
ATCTCAAGAACTACTGGGACACGCCCGACGGAAAGAAGCACGACTTTACCCACACCATCCATCAGCTGCGATTCG
GCCCTCAGCTCCCGGACGACGTCAAGCAGAAGCTGGGAGGCTCCGGGGCGATGCCATGGACCAACCACCACCTCA
ATCCGCTGGATGGGGCCCAGCACGACACCACCGACTCGAACCTCAACTACATGTATTTCGTCAAGATCGTCCCCA
CGTCATACCTGCCCCTTGGCTGGGAGAAGAAGATGCAGCGGCTGCCCGGCGTCATGGACGGCAGCGCCGACGGCA
GCGTCGAGACACACCAGTACTCTGTCACGAGCCACAAGCGGAGCCTCAGCGGCGGTAATGACGCGGCCGAGGGCC
ACGCCGAGCGCCAGCACTCCAAGGGCGGCATACCGGGCGTGTTCTTCTCATATGTAACCCCCCCCCCCCATCTCC
CGAAAACCGTGACGAGCGCACGAAGGCAGCTAACAAGCGGCGCAGGACATTTCTCCGATGAAAGTGATCAACCGC
GAGGAGCAGTCCAAGTCCTTCCTCGGGTTCCTGGCAGGTCTTTGTGCCATTGTCGGTGGCACGCTGACAGTGGCT
GCCGCCGTGGACCGCGGGCTGTTTGAGGGTGCGACGCGATTGAAGAAGATGCGATCGAAAGACCTGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail