Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3408
Gene name
Locationscaffold_27:56065..58009
Strand+
Gene length (bp)1944
Transcript length (bp)1536
Coding sequence length (bp)1533
Protein length (aa) 511

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02133 Transp_cyt_pur Permease for cytosine/purines, uracil, thiamine, allantoin 4.0E-28 73 473

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|C8V329|FCY2_EMENI Purine-cytosine permease fcyB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=fcyB PE=1 SV=1 9 495 4.0E-69
sp|P17064|FCY2_YEAST Purine-cytosine permease FCY2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FCY2 PE=1 SV=2 18 502 9.0E-68
sp|P40039|FCY21_YEAST Purine-cytosine permease FCY21 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FCY21 PE=1 SV=2 42 510 1.0E-67
sp|Q12119|FCY22_YEAST Purine-cytosine permease FCY22 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FCY22 PE=3 SV=1 42 502 1.0E-64
sp|P53099|TPN1_YEAST Vitamin B6 transporter TPN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPN1 PE=1 SV=1 34 493 5.0E-36
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|C8V329|FCY2_EMENI Purine-cytosine permease fcyB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=fcyB PE=1 SV=1 9 495 4.0E-69
sp|P17064|FCY2_YEAST Purine-cytosine permease FCY2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FCY2 PE=1 SV=2 18 502 9.0E-68
sp|P40039|FCY21_YEAST Purine-cytosine permease FCY21 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FCY21 PE=1 SV=2 42 510 1.0E-67
sp|Q12119|FCY22_YEAST Purine-cytosine permease FCY22 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FCY22 PE=3 SV=1 42 502 1.0E-64
sp|P53099|TPN1_YEAST Vitamin B6 transporter TPN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPN1 PE=1 SV=1 34 493 5.0E-36
sp|Q874L4|TPN1_YEASX Vitamin B6 transporter TPN1 OS=Saccharomyces cerevisiae GN=TPN1 PE=3 SV=1 34 493 9.0E-36
sp|P94369|YXLA_BACSU Putative purine-cytosine permease YxlA OS=Bacillus subtilis (strain 168) GN=yxlA PE=3 SV=1 55 502 3.0E-10
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0016020 membrane Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0110165 cellular anatomical entity No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.45

Transmembrane Domains

Domain # Start End Length
1 74 96 22
2 106 128 22
3 149 171 22
4 186 208 22
5 215 234 19
6 249 266 17
7 286 308 22
8 323 345 22
9 350 369 19
10 379 401 22
11 406 428 22
12 443 465 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 3.25 0.76 5.74
CcL In ants, during behavior modification 11.48 4.38 18.58
CcD In ants, recently dead 8.38 3.07 13.69

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.000770 yes
SC16a CcD 0.008585 yes
CcL CcD 0.339291 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3408
MADDGLRGDETVEGKPAPRQVVGSGSLTGGGVDEAANPSSASSMQRLAKMLRASRVEENGVRPLRVDERDNTRFV
SILTVWVSINSNILGITFGMLGPSVYGLGLGHSALVILFFGLLSTLAPAYLAVFGPKTGMRQMIQARYSFGRYLV
SVPVLLNLATLTGFTVVICVVGGQCLAAVSDGGLTPNVGIVVIALLSLLVSFAGFAVLHLFESYAFLFALVSIAV
TAGVGGHGLSRQSQPEHPPSARQLLNFGMIVAGYQVPWAAIASDLTTYFDPRVPSWRVFHYTYWGLLTPTVLLMG
LGAAVAGAVPNNPDWQDRYSKNLVGGALAGMLSGAGGFGKFVLVVLSLTLLGNTCGTCYAITLNFQTLVPWLTAV
PRPIFSVVITAIVIPVSMAAATSFLTSLENLVALIGYWSAAFVGIILAEHLVFRRGRFDAYDTAVWDSAARLPPG
VAALAAGVLALGLVVPCMDQAWWTGSIARKTGDIGFEIAFVLSALLRSIQLSDIIQSIARA
Coding >Ophio5|3408
ATGGCTGACGATGGCTTGCGCGGCGATGAGACGGTCGAGGGAAAGCCGGCTCCAAGGCAGGTGGTAGGCAGCGGC
AGCCTCACCGGCGGCGGCGTCGATGAAGCCGCGAACCCCTCGTCAGCCTCGTCGATGCAGCGGCTGGCCAAGATG
CTACGTGCCAGCCGCGTGGAGGAGAACGGCGTCCGGCCGCTGCGCGTCGATGAGCGCGACAATACGCGCTTCGTC
AGCATCTTGACCGTCTGGGTCTCCATCAACTCTAACATCCTCGGCATCACGTTTGGCATGCTCGGACCCTCCGTC
TACGGCCTCGGCCTCGGCCACTCAGCCCTCGTCATCCTCTTCTTCGGCCTGCTGTCCACCCTTGCGCCCGCTTAC
CTGGCCGTCTTCGGGCCCAAGACGGGCATGAGGCAGATGATCCAGGCGCGCTACAGCTTCGGCCGCTATCTCGTC
TCCGTCCCTGTGCTGCTCAATCTGGCCACCCTGACCGGCTTCACCGTCGTCATCTGCGTCGTCGGCGGTCAATGC
CTCGCAGCCGTGTCCGACGGTGGGCTGACGCCCAACGTGGGCATCGTCGTCATTGCCCTGCTGTCTCTGCTCGTC
TCCTTTGCCGGCTTCGCCGTGCTGCACCTCTTCGAGTCGTATGCCTTCCTGTTTGCCCTCGTCAGCATCGCCGTT
ACCGCCGGCGTCGGCGGTCACGGCCTCAGCCGCCAGTCTCAGCCCGAACACCCCCCTTCGGCCCGTCAGTTGCTC
AACTTTGGCATGATCGTGGCCGGCTACCAGGTCCCCTGGGCGGCCATAGCCAGCGATCTGACGACGTACTTTGAC
CCCCGCGTTCCGTCCTGGCGCGTCTTTCACTATACCTACTGGGGGCTCCTGACGCCGACGGTGCTGCTTATGGGG
CTCGGCGCCGCCGTTGCCGGAGCCGTTCCCAACAACCCGGACTGGCAGGATAGGTACAGCAAGAACCTCGTGGGC
GGCGCCCTGGCCGGCATGTTGTCCGGGGCTGGCGGCTTCGGCAAGTTCGTCCTCGTCGTCCTATCGCTGACGCTG
CTTGGAAACACGTGCGGCACCTGCTACGCCATCACGCTGAACTTCCAGACGCTGGTGCCGTGGCTGACCGCGGTG
CCGCGTCCCATCTTCTCAGTTGTCATCACCGCCATCGTGATTCCCGTGTCCATGGCTGCGGCCACCAGCTTCTTG
ACTAGCCTTGAGAATCTCGTGGCCCTTATTGGCTACTGGTCCGCCGCCTTCGTGGGCATCATCCTCGCTGAGCAT
CTCGTCTTCCGCCGCGGCCGCTTCGACGCCTACGACACCGCTGTGTGGGACTCGGCCGCGAGGTTGCCCCCTGGC
GTTGCCGCCCTGGCCGCCGGTGTCCTTGCCCTCGGCCTCGTCGTTCCCTGCATGGACCAGGCTTGGTGGACGGGG
TCCATCGCCAGGAAAACGGGCGACATTGGCTTCGAGATTGCGTTTGTGCTTAGCGCCCTGCTGCGTTCTATACAA
TTGTCCGATATTATCCAAAGCATAGCCCGAGCG
Transcript >Ophio5|3408
ATGGCTGACGATGGCTTGCGCGGCGATGAGACGGTCGAGGGAAAGCCGGCTCCAAGGCAGGTGGTAGGCAGCGGC
AGCCTCACCGGCGGCGGCGTCGATGAAGCCGCGAACCCCTCGTCAGCCTCGTCGATGCAGCGGCTGGCCAAGATG
CTACGTGCCAGCCGCGTGGAGGAGAACGGCGTCCGGCCGCTGCGCGTCGATGAGCGCGACAATACGCGCTTCGTC
AGCATCTTGACCGTCTGGGTCTCCATCAACTCTAACATCCTCGGCATCACGTTTGGCATGCTCGGACCCTCCGTC
TACGGCCTCGGCCTCGGCCACTCAGCCCTCGTCATCCTCTTCTTCGGCCTGCTGTCCACCCTTGCGCCCGCTTAC
CTGGCCGTCTTCGGGCCCAAGACGGGCATGAGGCAGATGATCCAGGCGCGCTACAGCTTCGGCCGCTATCTCGTC
TCCGTCCCTGTGCTGCTCAATCTGGCCACCCTGACCGGCTTCACCGTCGTCATCTGCGTCGTCGGCGGTCAATGC
CTCGCAGCCGTGTCCGACGGTGGGCTGACGCCCAACGTGGGCATCGTCGTCATTGCCCTGCTGTCTCTGCTCGTC
TCCTTTGCCGGCTTCGCCGTGCTGCACCTCTTCGAGTCGTATGCCTTCCTGTTTGCCCTCGTCAGCATCGCCGTT
ACCGCCGGCGTCGGCGGTCACGGCCTCAGCCGCCAGTCTCAGCCCGAACACCCCCCTTCGGCCCGTCAGTTGCTC
AACTTTGGCATGATCGTGGCCGGCTACCAGGTCCCCTGGGCGGCCATAGCCAGCGATCTGACGACGTACTTTGAC
CCCCGCGTTCCGTCCTGGCGCGTCTTTCACTATACCTACTGGGGGCTCCTGACGCCGACGGTGCTGCTTATGGGG
CTCGGCGCCGCCGTTGCCGGAGCCGTTCCCAACAACCCGGACTGGCAGGATAGGTACAGCAAGAACCTCGTGGGC
GGCGCCCTGGCCGGCATGTTGTCCGGGGCTGGCGGCTTCGGCAAGTTCGTCCTCGTCGTCCTATCGCTGACGCTG
CTTGGAAACACGTGCGGCACCTGCTACGCCATCACGCTGAACTTCCAGACGCTGGTGCCGTGGCTGACCGCGGTG
CCGCGTCCCATCTTCTCAGTTGTCATCACCGCCATCGTGATTCCCGTGTCCATGGCTGCGGCCACCAGCTTCTTG
ACTAGCCTTGAGAATCTCGTGGCCCTTATTGGCTACTGGTCCGCCGCCTTCGTGGGCATCATCCTCGCTGAGCAT
CTCGTCTTCCGCCGCGGCCGCTTCGACGCCTACGACACCGCTGTGTGGGACTCGGCCGCGAGGTTGCCCCCTGGC
GTTGCCGCCCTGGCCGCCGGTGTCCTTGCCCTCGGCCTCGTCGTTCCCTGCATGGACCAGGCTTGGTGGACGGGG
TCCATCGCCAGGAAAACGGGCGACATTGGCTTCGAGATTGCGTTTGTGCTTAGCGCCCTGCTGCGTTCTATACAA
TTGTCCGATATTATCCAAAGCATAGCCCGAGCGTAA
Gene >Ophio5|3408
ATGGCTGACGATGGCTTGCGCGGCGATGAGACGGTCGAGGGAAAGCCGGCTCCAAGGCAGGTGGTAGGCAGCGGC
AGCCTCACCGGCGGCGGCGTCGATGAAGCCGCGAACCCCTCGTCAGCCTCGTCGATGCAGCGGCTGGCCAAGATG
CTACGTGCCAGCCGCGTGGAGGAGAACGGCGTCCGGCCGCTGCGCGTCGATGAGCGCGACAATACGCGCTTCGTC
AGCATCTTGACCGTCTGGGTCTCCATCAACTCTAACATCCTCGGGTGAGGCTGACACCCTCTCGTCTGCCCACGC
TGCATTGCTGAGGGGGGGGGAAGCATCACGTTTGGCATGCTCGGACCCTCCGTCTACGGCCTCGGCCTCGGCCAC
TCAGCCCTCGTCATCCTCTTCTTCGGCCTGCTGTCCACCCTTGCGCCCGCTTACCTGGCCGTCTTCGGGCCCAAG
ACGGGCATGAGGCAGATGATCCAGGCGCGCTACAGCTTCGGGTGTGCCAATCTCCCTATGAACCCTGTGCCAGGT
CTGTGCCCCAGATCTGTGCCGGATAGGGTGACGCCGGCTGACCGTCTCTCGCCCTCTGGACGCCCAGCCGCTATC
TCGTCTCCGTCCCTGTGCTGCTCAATCTGGCCACCCTGACCGGCTTCACCGTCGTCATCTGCGTCGTCGGCGGTC
AATGCCTCGCAGCCGTGTCCGACGGTGGGCTGACGCCCAACGTGGGCATCGTCGTCATTGCCCTGCTGTCTCTGC
TCGTCTCCTTTGCCGGCTTCGCCGTGCTGCACCTCTTCGAGTCGTATGCCTTCCTGTTTGCCCTCGTCAGCATCG
CCGTTACCGCCGGCGTCGGCGGTCACGGCCTCAGCCGCCAGTCTCAGCCCGAACACCCCCCTTCGGCCCGTCAGT
TGCTCAACTTTGGCATGATCGTGGCCGGCTACCAGGTCCCCTGGGCGGCCATAGCCAGCGATCTGACGACGTACT
TTGACCCCCGCGTTCCGTCGTCAGTCTTTTCTCCTTTCCTCCTCCCCTGTGGCTCTCCCGTGGCCTTCCCGTGGC
CGTCCCGTGGCCTTCCCGTGGCCTTCCCGTGGCCTTCCCGTGGTCCTCCCGTCGCGACGTGGACTGAACTGACGA
CCTCCCCAAGCTGGCGCGTCTTTCACTATACCTACTGGGGGCTCCTGACGCCGACGGTGCTGCTTATGGGGCTCG
GCGCCGCCGTTGCCGGAGCCGTTCCCAACAACCCGGACTGGCAGGATAGGTACAGCAAGAACCTCGTGGGCGGCG
CCCTGGCCGGCATGTTGTCCGGGGCTGGCGGCTTCGGCAAGTTCGTCCTCGTCGTCCTATCGCTGACGCTGCTTG
GAAACACGTGCGGCACCTGCTACGCCATCACGCTGAACTTCCAGACGCTGGTGCCGTGGCTGACCGCGGTGCCGC
GTCCCATCTTCTCAGTTGTCATCACCGCCATCGTGATTCCCGTGTCCATGGCTGCGGCCACCAGCTTCTTGACTA
GCCTTGAGAATCTCGTGGCCCTTATTGGCTACTGGTCCGCCGCCTTCGTGGGCATCATCCTCGCTGAGCATCTCG
TCTTCCGCCGCGGCCGCTTCGACGCCTACGACACCGCTGTGTGGGACTCGGCCGCGAGGTTGCCCCCTGGCGTTG
CCGCCCTGGCCGCCGGTGTCCTTGCCCTCGGCCTCGTCGTTCCCTGCATGGACCAGGCTTGGTGGACGGGGTCCA
TCGCCAGGAAAACGGGCGACATTGGCTTCGAGATTGCGTTTGTGCTTAGCGCCCTGCTGTACGTGCCCTTTCGCC
ACCTCGAGAGGCGTCTAGCCGGCCGGTGACGAGGAGGCGTTCTATACAATTGTGAGAAAGCCAAAGTCTGTGCAA
ACACACGTCGTCATCGTCGGCTTACATCTCACAAGGTCCGATATTATCCAAAGCATAGCCCGAGCGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail