Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3408
Gene name
Locationscaffold_27:56065..58009
Strand+
Gene length (bp)1944
Transcript length (bp)1536
Coding sequence length (bp)1533
Protein length (aa) 511

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02133 Transp_cyt_pur Permease for cytosine/purines, uracil, thiamine, allantoin 4.0E-28 73 473

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|C8V329|FCY2_EMENI Purine-cytosine permease fcyB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=fcyB PE=1 SV=1 9 495 4.0E-69
sp|P17064|FCY2_YEAST Purine-cytosine permease FCY2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FCY2 PE=1 SV=2 18 502 9.0E-68
sp|P40039|FCY21_YEAST Purine-cytosine permease FCY21 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FCY21 PE=1 SV=2 42 510 1.0E-67
sp|Q12119|FCY22_YEAST Purine-cytosine permease FCY22 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FCY22 PE=3 SV=1 42 502 1.0E-64
sp|P53099|TPN1_YEAST Vitamin B6 transporter TPN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPN1 PE=1 SV=1 34 493 5.0E-36
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|C8V329|FCY2_EMENI Purine-cytosine permease fcyB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=fcyB PE=1 SV=1 9 495 4.0E-69
sp|P17064|FCY2_YEAST Purine-cytosine permease FCY2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FCY2 PE=1 SV=2 18 502 9.0E-68
sp|P40039|FCY21_YEAST Purine-cytosine permease FCY21 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FCY21 PE=1 SV=2 42 510 1.0E-67
sp|Q12119|FCY22_YEAST Purine-cytosine permease FCY22 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FCY22 PE=3 SV=1 42 502 1.0E-64
sp|P53099|TPN1_YEAST Vitamin B6 transporter TPN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPN1 PE=1 SV=1 34 493 5.0E-36
sp|Q874L4|TPN1_YEASX Vitamin B6 transporter TPN1 OS=Saccharomyces cerevisiae GN=TPN1 PE=3 SV=1 34 493 9.0E-36
sp|P94369|YXLA_BACSU Putative purine-cytosine permease YxlA OS=Bacillus subtilis (strain 168) GN=yxlA PE=3 SV=1 55 502 3.0E-10
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0016020 membrane Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0110165 cellular anatomical entity No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.45

Transmembrane Domains

Domain # Start End Length
1 74 96 22
2 106 128 22
3 149 171 22
4 186 208 22
5 215 234 19
6 249 266 17
7 286 308 22
8 323 345 22
9 350 369 19
10 379 401 22
11 406 428 22
12 443 465 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3408
MADDGLRGDETVEGKPAPRQVVGSGSLTGGGVDEAANPSSASSMQRLAKMLRASRVEENGVRPLRVDERDNTRFV
SILTVWVSINSNILGITFGMLGPSVYGLGLGHSALVILFFGLLSTLAPAYLAVFGPKTGMRQMIQARYSFGRYLV
SVPVLLNLATLTGFTVVICVVGGQCLAAVSDGGLTPNVGIVVIALLSLLVSFAGFAVLHLFESYAFLFALVSIAV
TAGVGGHGLSRQSQPEHPPSARQLLNFGMIVAGYQVPWAAIASDLTTYFDPRVPSWRVFHYTYWGLLTPTVLLMG
LGAAVAGAVPNNPDWQDRYSKNLVGGALAGMLSGAGGFGKFVLVVLSLTLLGNTCGTCYAITLNFQTLVPWLTAV
PRPIFSVVITAIVIPVSMAAATSFLTSLENLVALIGYWSAAFVGIILAEHLVFRRGRFDAYDTAVWDSAARLPPG
VAALAAGVLALGLVVPCMDQAWWTGSIARKTGDIGFEIAFVLSALLRSIQLSDIIQSIARA
Coding >Ophio5|3408
ATGGCTGACGATGGCTTGCGCGGCGATGAGACGGTCGAGGGAAAGCCGGCTCCAAGGCAGGTGGTAGGCAGCGGC
AGCCTCACCGGCGGCGGCGTCGATGAAGCCGCGAACCCCTCGTCAGCCTCGTCGATGCAGCGGCTGGCCAAGATG
CTACGTGCCAGCCGCGTGGAGGAGAACGGCGTCCGGCCGCTGCGCGTCGATGAGCGCGACAATACGCGCTTCGTC
AGCATCTTGACCGTCTGGGTCTCCATCAACTCTAACATCCTCGGCATCACGTTTGGCATGCTCGGACCCTCCGTC
TACGGCCTCGGCCTCGGCCACTCAGCCCTCGTCATCCTCTTCTTCGGCCTGCTGTCCACCCTTGCGCCCGCTTAC
CTGGCCGTCTTCGGGCCCAAGACGGGCATGAGGCAGATGATCCAGGCGCGCTACAGCTTCGGCCGCTATCTCGTC
TCCGTCCCTGTGCTGCTCAATCTGGCCACCCTGACCGGCTTCACCGTCGTCATCTGCGTCGTCGGCGGTCAATGC
CTCGCAGCCGTGTCCGACGGTGGGCTGACGCCCAACGTGGGCATCGTCGTCATTGCCCTGCTGTCTCTGCTCGTC
TCCTTTGCCGGCTTCGCCGTGCTGCACCTCTTCGAGTCGTATGCCTTCCTGTTTGCCCTCGTCAGCATCGCCGTT
ACCGCCGGCGTCGGCGGTCACGGCCTCAGCCGCCAGTCTCAGCCCGAACACCCCCCTTCGGCCCGTCAGTTGCTC
AACTTTGGCATGATCGTGGCCGGCTACCAGGTCCCCTGGGCGGCCATAGCCAGCGATCTGACGACGTACTTTGAC
CCCCGCGTTCCGTCCTGGCGCGTCTTTCACTATACCTACTGGGGGCTCCTGACGCCGACGGTGCTGCTTATGGGG
CTCGGCGCCGCCGTTGCCGGAGCCGTTCCCAACAACCCGGACTGGCAGGATAGGTACAGCAAGAACCTCGTGGGC
GGCGCCCTGGCCGGCATGTTGTCCGGGGCTGGCGGCTTCGGCAAGTTCGTCCTCGTCGTCCTATCGCTGACGCTG
CTTGGAAACACGTGCGGCACCTGCTACGCCATCACGCTGAACTTCCAGACGCTGGTGCCGTGGCTGACCGCGGTG
CCGCGTCCCATCTTCTCAGTTGTCATCACCGCCATCGTGATTCCCGTGTCCATGGCTGCGGCCACCAGCTTCTTG
ACTAGCCTTGAGAATCTCGTGGCCCTTATTGGCTACTGGTCCGCCGCCTTCGTGGGCATCATCCTCGCTGAGCAT
CTCGTCTTCCGCCGCGGCCGCTTCGACGCCTACGACACCGCTGTGTGGGACTCGGCCGCGAGGTTGCCCCCTGGC
GTTGCCGCCCTGGCCGCCGGTGTCCTTGCCCTCGGCCTCGTCGTTCCCTGCATGGACCAGGCTTGGTGGACGGGG
TCCATCGCCAGGAAAACGGGCGACATTGGCTTCGAGATTGCGTTTGTGCTTAGCGCCCTGCTGCGTTCTATACAA
TTGTCCGATATTATCCAAAGCATAGCCCGAGCG
Transcript >Ophio5|3408
ATGGCTGACGATGGCTTGCGCGGCGATGAGACGGTCGAGGGAAAGCCGGCTCCAAGGCAGGTGGTAGGCAGCGGC
AGCCTCACCGGCGGCGGCGTCGATGAAGCCGCGAACCCCTCGTCAGCCTCGTCGATGCAGCGGCTGGCCAAGATG
CTACGTGCCAGCCGCGTGGAGGAGAACGGCGTCCGGCCGCTGCGCGTCGATGAGCGCGACAATACGCGCTTCGTC
AGCATCTTGACCGTCTGGGTCTCCATCAACTCTAACATCCTCGGCATCACGTTTGGCATGCTCGGACCCTCCGTC
TACGGCCTCGGCCTCGGCCACTCAGCCCTCGTCATCCTCTTCTTCGGCCTGCTGTCCACCCTTGCGCCCGCTTAC
CTGGCCGTCTTCGGGCCCAAGACGGGCATGAGGCAGATGATCCAGGCGCGCTACAGCTTCGGCCGCTATCTCGTC
TCCGTCCCTGTGCTGCTCAATCTGGCCACCCTGACCGGCTTCACCGTCGTCATCTGCGTCGTCGGCGGTCAATGC
CTCGCAGCCGTGTCCGACGGTGGGCTGACGCCCAACGTGGGCATCGTCGTCATTGCCCTGCTGTCTCTGCTCGTC
TCCTTTGCCGGCTTCGCCGTGCTGCACCTCTTCGAGTCGTATGCCTTCCTGTTTGCCCTCGTCAGCATCGCCGTT
ACCGCCGGCGTCGGCGGTCACGGCCTCAGCCGCCAGTCTCAGCCCGAACACCCCCCTTCGGCCCGTCAGTTGCTC
AACTTTGGCATGATCGTGGCCGGCTACCAGGTCCCCTGGGCGGCCATAGCCAGCGATCTGACGACGTACTTTGAC
CCCCGCGTTCCGTCCTGGCGCGTCTTTCACTATACCTACTGGGGGCTCCTGACGCCGACGGTGCTGCTTATGGGG
CTCGGCGCCGCCGTTGCCGGAGCCGTTCCCAACAACCCGGACTGGCAGGATAGGTACAGCAAGAACCTCGTGGGC
GGCGCCCTGGCCGGCATGTTGTCCGGGGCTGGCGGCTTCGGCAAGTTCGTCCTCGTCGTCCTATCGCTGACGCTG
CTTGGAAACACGTGCGGCACCTGCTACGCCATCACGCTGAACTTCCAGACGCTGGTGCCGTGGCTGACCGCGGTG
CCGCGTCCCATCTTCTCAGTTGTCATCACCGCCATCGTGATTCCCGTGTCCATGGCTGCGGCCACCAGCTTCTTG
ACTAGCCTTGAGAATCTCGTGGCCCTTATTGGCTACTGGTCCGCCGCCTTCGTGGGCATCATCCTCGCTGAGCAT
CTCGTCTTCCGCCGCGGCCGCTTCGACGCCTACGACACCGCTGTGTGGGACTCGGCCGCGAGGTTGCCCCCTGGC
GTTGCCGCCCTGGCCGCCGGTGTCCTTGCCCTCGGCCTCGTCGTTCCCTGCATGGACCAGGCTTGGTGGACGGGG
TCCATCGCCAGGAAAACGGGCGACATTGGCTTCGAGATTGCGTTTGTGCTTAGCGCCCTGCTGCGTTCTATACAA
TTGTCCGATATTATCCAAAGCATAGCCCGAGCGTAA
Gene >Ophio5|3408
ATGGCTGACGATGGCTTGCGCGGCGATGAGACGGTCGAGGGAAAGCCGGCTCCAAGGCAGGTGGTAGGCAGCGGC
AGCCTCACCGGCGGCGGCGTCGATGAAGCCGCGAACCCCTCGTCAGCCTCGTCGATGCAGCGGCTGGCCAAGATG
CTACGTGCCAGCCGCGTGGAGGAGAACGGCGTCCGGCCGCTGCGCGTCGATGAGCGCGACAATACGCGCTTCGTC
AGCATCTTGACCGTCTGGGTCTCCATCAACTCTAACATCCTCGGGTGAGGCTGACACCCTCTCGTCTGCCCACGC
TGCATTGCTGAGGGGGGGGGAAGCATCACGTTTGGCATGCTCGGACCCTCCGTCTACGGCCTCGGCCTCGGCCAC
TCAGCCCTCGTCATCCTCTTCTTCGGCCTGCTGTCCACCCTTGCGCCCGCTTACCTGGCCGTCTTCGGGCCCAAG
ACGGGCATGAGGCAGATGATCCAGGCGCGCTACAGCTTCGGGTGTGCCAATCTCCCTATGAACCCTGTGCCAGGT
CTGTGCCCCAGATCTGTGCCGGATAGGGTGACGCCGGCTGACCGTCTCTCGCCCTCTGGACGCCCAGCCGCTATC
TCGTCTCCGTCCCTGTGCTGCTCAATCTGGCCACCCTGACCGGCTTCACCGTCGTCATCTGCGTCGTCGGCGGTC
AATGCCTCGCAGCCGTGTCCGACGGTGGGCTGACGCCCAACGTGGGCATCGTCGTCATTGCCCTGCTGTCTCTGC
TCGTCTCCTTTGCCGGCTTCGCCGTGCTGCACCTCTTCGAGTCGTATGCCTTCCTGTTTGCCCTCGTCAGCATCG
CCGTTACCGCCGGCGTCGGCGGTCACGGCCTCAGCCGCCAGTCTCAGCCCGAACACCCCCCTTCGGCCCGTCAGT
TGCTCAACTTTGGCATGATCGTGGCCGGCTACCAGGTCCCCTGGGCGGCCATAGCCAGCGATCTGACGACGTACT
TTGACCCCCGCGTTCCGTCGTCAGTCTTTTCTCCTTTCCTCCTCCCCTGTGGCTCTCCCGTGGCCTTCCCGTGGC
CGTCCCGTGGCCTTCCCGTGGCCTTCCCGTGGCCTTCCCGTGGTCCTCCCGTCGCGACGTGGACTGAACTGACGA
CCTCCCCAAGCTGGCGCGTCTTTCACTATACCTACTGGGGGCTCCTGACGCCGACGGTGCTGCTTATGGGGCTCG
GCGCCGCCGTTGCCGGAGCCGTTCCCAACAACCCGGACTGGCAGGATAGGTACAGCAAGAACCTCGTGGGCGGCG
CCCTGGCCGGCATGTTGTCCGGGGCTGGCGGCTTCGGCAAGTTCGTCCTCGTCGTCCTATCGCTGACGCTGCTTG
GAAACACGTGCGGCACCTGCTACGCCATCACGCTGAACTTCCAGACGCTGGTGCCGTGGCTGACCGCGGTGCCGC
GTCCCATCTTCTCAGTTGTCATCACCGCCATCGTGATTCCCGTGTCCATGGCTGCGGCCACCAGCTTCTTGACTA
GCCTTGAGAATCTCGTGGCCCTTATTGGCTACTGGTCCGCCGCCTTCGTGGGCATCATCCTCGCTGAGCATCTCG
TCTTCCGCCGCGGCCGCTTCGACGCCTACGACACCGCTGTGTGGGACTCGGCCGCGAGGTTGCCCCCTGGCGTTG
CCGCCCTGGCCGCCGGTGTCCTTGCCCTCGGCCTCGTCGTTCCCTGCATGGACCAGGCTTGGTGGACGGGGTCCA
TCGCCAGGAAAACGGGCGACATTGGCTTCGAGATTGCGTTTGTGCTTAGCGCCCTGCTGTACGTGCCCTTTCGCC
ACCTCGAGAGGCGTCTAGCCGGCCGGTGACGAGGAGGCGTTCTATACAATTGTGAGAAAGCCAAAGTCTGTGCAA
ACACACGTCGTCATCGTCGGCTTACATCTCACAAGGTCCGATATTATCCAAAGCATAGCCCGAGCGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail