Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3405
Gene name
Locationscaffold_27:47124..48246
Strand-
Gene length (bp)1122
Transcript length (bp)1062
Coding sequence length (bp)1059
Protein length (aa) 353

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01370 Epimerase NAD dependent epimerase/dehydratase family 1.1E-15 10 193
PF16363 GDP_Man_Dehyd GDP-mannose 4,6 dehydratase 1.4E-11 11 131
PF01073 3Beta_HSD 3-beta hydroxysteroid dehydrogenase/isomerase family 9.9E-10 11 158
PF07993 NAD_binding_4 Male sterility protein 2.1E-07 12 195
PF13460 NAD_binding_10 NAD(P)H-binding 7.7E-09 14 135
PF05368 NmrA NmrA-like family 4.4E-06 10 130
PF02719 Polysacc_synt_2 Polysaccharide biosynthesis protein 2.0E-05 10 135

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UUN9|ALD2_SPOSA Aldehyde reductase 2 OS=Sporidiobolus salmonicolor PE=1 SV=3 4 341 4.0E-79
sp|Q9UT59|YKJ7_SCHPO Putative uncharacterized oxidoreductase C513.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC513.07 PE=3 SV=1 6 285 3.0E-33
sp|P83775|GRP2_CANAL Putative NADPH-dependent methylglyoxal reductase GRP2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GRP2 PE=1 SV=2 4 285 1.0E-27
sp|Q9XES5|DFRA_MALDO Bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase OS=Malus domestica GN=DFR PE=1 SV=1 10 216 7.0E-25
sp|Q84KP0|DFRA_PYRCO Bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase OS=Pyrus communis GN=DFR PE=1 SV=1 10 216 9.0E-25
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UUN9|ALD2_SPOSA Aldehyde reductase 2 OS=Sporidiobolus salmonicolor PE=1 SV=3 4 341 4.0E-79
sp|Q9UT59|YKJ7_SCHPO Putative uncharacterized oxidoreductase C513.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC513.07 PE=3 SV=1 6 285 3.0E-33
sp|P83775|GRP2_CANAL Putative NADPH-dependent methylglyoxal reductase GRP2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GRP2 PE=1 SV=2 4 285 1.0E-27
sp|Q9XES5|DFRA_MALDO Bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase OS=Malus domestica GN=DFR PE=1 SV=1 10 216 7.0E-25
sp|Q84KP0|DFRA_PYRCO Bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase OS=Pyrus communis GN=DFR PE=1 SV=1 10 216 9.0E-25
sp|P51102|DFRA_ARATH Dihydroflavonol-4-reductase OS=Arabidopsis thaliana GN=DFRA PE=1 SV=2 10 216 2.0E-24
sp|P51110|DFRA_VITVI Dihydroflavonol-4-reductase OS=Vitis vinifera GN=DFR PE=1 SV=1 10 216 2.0E-23
sp|O94563|YGD4_SCHPO Putative uncharacterized oxidoreductase C1773.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1773.04 PE=1 SV=1 9 282 3.0E-23
sp|Q500U8|TKPR1_ARATH Tetraketide alpha-pyrone reductase 1 OS=Arabidopsis thaliana GN=TKPR1 PE=1 SV=1 10 341 4.0E-22
sp|Q12068|GRE2_YEAST NADPH-dependent methylglyoxal reductase GRE2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GRE2 PE=1 SV=1 10 283 4.0E-21
sp|P51106|DFRA_HORVU Dihydroflavonol-4-reductase OS=Hordeum vulgare GN=ANT18 PE=3 SV=1 6 216 2.0E-20
sp|Q9CA28|TKPR2_ARATH Tetraketide alpha-pyrone reductase 2 OS=Arabidopsis thaliana GN=TKPR2 PE=1 SV=1 11 351 5.0E-20
sp|P51105|DFRA_GERHY Dihydroflavonol-4-reductase OS=Gerbera hybrida GN=DFR PE=2 SV=1 10 216 7.0E-20
sp|P51109|DFRA_MEDSA Dihydroflavonol-4-reductase (Fragment) OS=Medicago sativa GN=DFR1 PE=2 SV=1 20 216 9.0E-20
sp|P53183|YGD9_YEAST Putative uncharacterized oxidoreductase YGL039W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YGL039W PE=1 SV=1 8 320 1.0E-19
sp|P53111|ARI1_YEAST NADPH-dependent aldehyde reductase ARI1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARI1 PE=1 SV=1 8 283 6.0E-19
sp|P51107|DFRA_SOLLC Dihydroflavonol-4-reductase OS=Solanum lycopersicum PE=2 SV=1 5 216 3.0E-18
sp|P14720|DFRA_PETHY Dihydroflavonol-4-reductase OS=Petunia hybrida GN=DFRA PE=2 SV=2 3 216 5.0E-18
sp|P51104|DFRA_DIACA Dihydroflavonol-4-reductase OS=Dianthus caryophyllus GN=A PE=2 SV=1 4 216 7.0E-18
sp|Q03049|YD541_YEAST Putative uncharacterized oxidoreductase YDR541C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDR541C PE=3 SV=2 10 285 3.0E-17
sp|P14721|DFRA_ANTMA Dihydroflavonol-4-reductase OS=Antirrhinum majus GN=DFRA PE=2 SV=1 3 216 3.0E-17
sp|P51108|DFRA_MAIZE Dihydroflavonol-4-reductase OS=Zea mays GN=A1 PE=3 SV=1 10 151 8.0E-17
sp|Q9SEV0|BAN_ARATH Anthocyanidin reductase OS=Arabidopsis thaliana GN=BAN PE=1 SV=2 12 201 1.0E-15
sp|Q40316|VESTR_MEDSA Vestitone reductase OS=Medicago sativa PE=1 SV=1 10 266 1.0E-14
sp|Q9SAH9|CCR2_ARATH Cinnamoyl-CoA reductase 2 OS=Arabidopsis thaliana GN=CCR2 PE=1 SV=1 6 184 2.0E-14
sp|Q9S9N9|CCR1_ARATH Cinnamoyl-CoA reductase 1 OS=Arabidopsis thaliana GN=CCR1 PE=1 SV=1 3 151 8.0E-14
sp|P51103|DFRA_CALCH Dihydroflavonol-4-reductase OS=Callistephus chinensis GN=F PE=2 SV=1 10 216 9.0E-14
sp|O22133|BEN1_ARATH Protein BRI1-5 ENHANCED 1 OS=Arabidopsis thaliana GN=BEN1 PE=2 SV=1 9 216 5.0E-09
sp|P73212|DFRA_SYNY3 Putative dihydroflavonol-4-reductase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=dfrA PE=3 SV=1 11 201 3.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor Yes
GO:0006694 steroid biosynthetic process Yes
GO:0003854 3-beta-hydroxy-delta5-steroid dehydrogenase activity Yes
GO:1901360 organic cyclic compound metabolic process No
GO:0009058 biosynthetic process No
GO:0008150 biological_process No
GO:0016614 oxidoreductase activity, acting on CH-OH group of donors No
GO:0044238 primary metabolic process No
GO:0016491 oxidoreductase activity No
GO:0016229 steroid dehydrogenase activity No
GO:1901576 organic substance biosynthetic process No
GO:0008152 metabolic process No
GO:0003674 molecular_function No
GO:0033764 steroid dehydrogenase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor No
GO:0008202 steroid metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006629 lipid metabolic process No
GO:0008610 lipid biosynthetic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0003824 catalytic activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Peroxisomal targeting signal 0.5551 0.2411 0.3822 0.1219 0.1909 0.0158 0.308 0.203 0.196 0.2755

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 0.62 0.00 1.48
CcL In ants, during behavior modification 146.09 20.73 271.44
CcD In ants, recently dead 32.27 14.97 49.57

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.000286 yes
SC16a CcD 0.000286 yes
CcL CcD 0.000286 yes

Orthologs

Orthofinder run ID4
Orthogroup969
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|814
Ophiocordyceps australis map64 (Brazil) OphauB2|6339
Ophiocordyceps camponoti-floridani Ophcf2|03723
Ophiocordyceps camponoti-rufipedis Ophun1|4699
Ophiocordyceps kimflemingae Ophio5|3405 (this protein)
Ophiocordyceps subramaniannii Hirsu2|7679

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3405
MPAIPNGSLILVTGVNGYIGSHVAEQLLEHGFRVRGTVRDAYKAEYMRAIFDEKYGKDAFEVRTVEDMATSGAFD
DVMKGCTGVMHVASDLTLNPDPHKVIPMVVSGVQNVLAAAAREPSVKRFVFTSSSAAATPPISNKRFHVDAETWN
DEEIEVAWAPPPYNDDRKLAVYAASKTLAEKECWRFMQEEKPSFVLNTVLPNCNIGRILSEDQPASTGGWYKKLW
EGDEEILDLLWNFPPQHFVNTTDTALLHLAALREEDVVGERLLAFAGPFNFNDTVDVLEKIQADGFGDGSKRFTK
ISSTAKDLKIVDTKRSQELLRRYNRPGFASLEESLKEVVESCRVFAQKRSLQG
Coding >Ophio5|3405
ATGCCGGCCATCCCGAATGGATCCCTCATCCTTGTTACAGGCGTAAATGGATACATCGGCAGTCATGTCGCCGAA
CAACTCCTCGAGCATGGCTTTCGCGTTCGTGGCACCGTCCGTGATGCCTACAAGGCCGAGTACATGCGTGCAATT
TTCGATGAGAAGTACGGCAAAGATGCTTTTGAAGTTCGCACAGTCGAGGATATGGCCACAAGCGGCGCCTTTGAC
GATGTTATGAAGGGCTGTACAGGCGTCATGCACGTTGCTTCTGATCTTACGCTCAATCCGGATCCTCACAAAGTC
ATACCTATGGTGGTTTCTGGTGTTCAAAACGTACTCGCAGCAGCGGCACGGGAACCAAGCGTGAAACGCTTCGTC
TTCACTTCATCGAGCGCCGCGGCAACACCACCTATTTCAAACAAGAGGTTTCACGTCGATGCGGAAACGTGGAAC
GACGAAGAAATCGAAGTAGCGTGGGCGCCCCCGCCCTATAACGACGACAGGAAGCTGGCTGTGTATGCAGCGAGC
AAGACGCTAGCAGAGAAGGAGTGTTGGCGCTTTATGCAGGAAGAGAAGCCGTCATTCGTTCTCAACACCGTTTTG
CCTAATTGCAACATTGGTAGAATCCTGTCCGAGGACCAGCCGGCGTCGACGGGCGGTTGGTATAAAAAGCTCTGG
GAGGGAGACGAGGAGATCCTCGACCTTTTGTGGAACTTTCCACCTCAACACTTCGTCAACACAACCGACACAGCG
CTTTTACACCTCGCAGCTTTACGCGAAGAGGACGTTGTTGGGGAGAGGCTCCTGGCATTTGCGGGCCCGTTCAAC
TTTAACGACACGGTGGATGTACTGGAGAAGATCCAGGCCGACGGCTTTGGAGACGGTAGCAAGCGATTCACCAAG
ATCTCCAGCACGGCAAAAGACCTGAAGATTGTGGATACGAAGAGATCTCAGGAACTCCTACGGAGATACAACAGG
CCGGGATTTGCGAGCTTGGAGGAGTCATTGAAGGAGGTCGTCGAGTCCTGCCGGGTCTTTGCCCAGAAGCGTTCT
CTACAGGGC
Transcript >Ophio5|3405
ATGCCGGCCATCCCGAATGGATCCCTCATCCTTGTTACAGGCGTAAATGGATACATCGGCAGTCATGTCGCCGAA
CAACTCCTCGAGCATGGCTTTCGCGTTCGTGGCACCGTCCGTGATGCCTACAAGGCCGAGTACATGCGTGCAATT
TTCGATGAGAAGTACGGCAAAGATGCTTTTGAAGTTCGCACAGTCGAGGATATGGCCACAAGCGGCGCCTTTGAC
GATGTTATGAAGGGCTGTACAGGCGTCATGCACGTTGCTTCTGATCTTACGCTCAATCCGGATCCTCACAAAGTC
ATACCTATGGTGGTTTCTGGTGTTCAAAACGTACTCGCAGCAGCGGCACGGGAACCAAGCGTGAAACGCTTCGTC
TTCACTTCATCGAGCGCCGCGGCAACACCACCTATTTCAAACAAGAGGTTTCACGTCGATGCGGAAACGTGGAAC
GACGAAGAAATCGAAGTAGCGTGGGCGCCCCCGCCCTATAACGACGACAGGAAGCTGGCTGTGTATGCAGCGAGC
AAGACGCTAGCAGAGAAGGAGTGTTGGCGCTTTATGCAGGAAGAGAAGCCGTCATTCGTTCTCAACACCGTTTTG
CCTAATTGCAACATTGGTAGAATCCTGTCCGAGGACCAGCCGGCGTCGACGGGCGGTTGGTATAAAAAGCTCTGG
GAGGGAGACGAGGAGATCCTCGACCTTTTGTGGAACTTTCCACCTCAACACTTCGTCAACACAACCGACACAGCG
CTTTTACACCTCGCAGCTTTACGCGAAGAGGACGTTGTTGGGGAGAGGCTCCTGGCATTTGCGGGCCCGTTCAAC
TTTAACGACACGGTGGATGTACTGGAGAAGATCCAGGCCGACGGCTTTGGAGACGGTAGCAAGCGATTCACCAAG
ATCTCCAGCACGGCAAAAGACCTGAAGATTGTGGATACGAAGAGATCTCAGGAACTCCTACGGAGATACAACAGG
CCGGGATTTGCGAGCTTGGAGGAGTCATTGAAGGAGGTCGTCGAGTCCTGCCGGGTCTTTGCCCAGAAGCGTTCT
CTACAGGGCTGA
Gene >Ophio5|3405
ATGCCGGCCATCCCGAATGGATCCCTCATCCTTGTTACAGGCGTAAATGGATACATCGGCAGTCATGTCGCCGAA
CAACTCCTCGAGCATGGCTTTCGCGTTCGTGGCACCGTCCGTGATGCCTACAAGGCCGAGTACATGCGTGCAATT
TTCGATGAGAAGTACGGCAAAGATGCTTTTGAAGTTCGCACAGTCGAGGATATGGCCACAAGCGGCGCCTTTGAC
GATGTTATGAAGGGTGGGATCCCACGCCTCGACACGCAGCCGCAGGAGCCAGATCTAAACTAACACTTTACAGGC
TGTACAGGCGTCATGCACGTTGCTTCTGATCTTACGCTCAATCCGGATCCTCACAAAGTCATACCTATGGTGGTT
TCTGGTGTTCAAAACGTACTCGCAGCAGCGGCACGGGAACCAAGCGTGAAACGCTTCGTCTTCACTTCATCGAGC
GCCGCGGCAACACCACCTATTTCAAACAAGAGGTTTCACGTCGATGCGGAAACGTGGAACGACGAAGAAATCGAA
GTAGCGTGGGCGCCCCCGCCCTATAACGACGACAGGAAGCTGGCTGTGTATGCAGCGAGCAAGACGCTAGCAGAG
AAGGAGTGTTGGCGCTTTATGCAGGAAGAGAAGCCGTCATTCGTTCTCAACACCGTTTTGCCTAATTGCAACATT
GGTAGAATCCTGTCCGAGGACCAGCCGGCGTCGACGGGCGGTTGGTATAAAAAGCTCTGGGAGGGAGACGAGGAG
ATCCTCGACCTTTTGTGGAACTTTCCACCTCAACACTTCGTCAACACAACCGACACAGCGCTTTTACACCTCGCA
GCTTTACGCGAAGAGGACGTTGTTGGGGAGAGGCTCCTGGCATTTGCGGGCCCGTTCAACTTTAACGACACGGTG
GATGTACTGGAGAAGATCCAGGCCGACGGCTTTGGAGACGGTAGCAAGCGATTCACCAAGATCTCCAGCACGGCA
AAAGACCTGAAGATTGTGGATACGAAGAGATCTCAGGAACTCCTACGGAGATACAACAGGCCGGGATTTGCGAGC
TTGGAGGAGTCATTGAAGGAGGTCGTCGAGTCCTGCCGGGTCTTTGCCCAGAAGCGTTCTCTACAGGGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail