Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3403
Gene name
Locationscaffold_27:44275..45319
Strand-
Gene length (bp)1044
Transcript length (bp)981
Coding sequence length (bp)978
Protein length (aa) 326

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00106 adh_short short chain dehydrogenase 1.8E-16 30 157
PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase 3.2E-08 40 158
PF08659 KR KR domain 1.2E-07 31 123

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8NBN7|RDH13_HUMAN Retinol dehydrogenase 13 OS=Homo sapiens GN=RDH13 PE=1 SV=2 24 310 4.0E-22
sp|Q6RVV4|TIC32_PEA Short-chain dehydrogenase TIC 32, chloroplastic OS=Pisum sativum GN=TIC32 PE=1 SV=1 29 308 2.0E-20
sp|A2RVM0|TIC32_ARATH Short-chain dehydrogenase TIC 32, chloroplastic OS=Arabidopsis thaliana GN=TIC32 PE=2 SV=1 29 308 5.0E-20
sp|Q8CEE7|RDH13_MOUSE Retinol dehydrogenase 13 OS=Mus musculus GN=Rdh13 PE=1 SV=1 24 310 2.0E-19
sp|Q8BYK4|RDH12_MOUSE Retinol dehydrogenase 12 OS=Mus musculus GN=Rdh12 PE=2 SV=1 29 285 5.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8NBN7|RDH13_HUMAN Retinol dehydrogenase 13 OS=Homo sapiens GN=RDH13 PE=1 SV=2 24 310 4.0E-22
sp|Q6RVV4|TIC32_PEA Short-chain dehydrogenase TIC 32, chloroplastic OS=Pisum sativum GN=TIC32 PE=1 SV=1 29 308 2.0E-20
sp|A2RVM0|TIC32_ARATH Short-chain dehydrogenase TIC 32, chloroplastic OS=Arabidopsis thaliana GN=TIC32 PE=2 SV=1 29 308 5.0E-20
sp|Q8CEE7|RDH13_MOUSE Retinol dehydrogenase 13 OS=Mus musculus GN=Rdh13 PE=1 SV=1 24 310 2.0E-19
sp|Q8BYK4|RDH12_MOUSE Retinol dehydrogenase 12 OS=Mus musculus GN=Rdh12 PE=2 SV=1 29 285 5.0E-18
sp|Q8TC12|RDH11_HUMAN Retinol dehydrogenase 11 OS=Homo sapiens GN=RDH11 PE=1 SV=2 29 313 3.0E-17
sp|P59837|RDH12_BOVIN Retinol dehydrogenase 12 OS=Bos taurus GN=RDH12 PE=2 SV=1 1 285 7.0E-17
sp|Q5F389|WWOX_CHICK WW domain-containing oxidoreductase OS=Gallus gallus GN=WWOX PE=2 SV=2 27 274 3.0E-16
sp|Q9VLU5|WWOX_DROME WW domain-containing oxidoreductase OS=Drosophila melanogaster GN=Wwox PE=2 SV=1 27 308 1.0E-15
sp|Q5SS80|DHR13_MOUSE Dehydrogenase/reductase SDR family member 13 OS=Mus musculus GN=Dhrs13 PE=1 SV=1 29 321 2.0E-15
sp|Q17QU7|DHR13_BOVIN Dehydrogenase/reductase SDR family member 13 OS=Bos taurus GN=DHRS13 PE=2 SV=1 11 321 5.0E-15
sp|Q9HBH5|RDH14_HUMAN Retinol dehydrogenase 14 OS=Homo sapiens GN=RDH14 PE=1 SV=1 29 245 2.0E-14
sp|Q9QYF1|RDH11_MOUSE Retinol dehydrogenase 11 OS=Mus musculus GN=Rdh11 PE=1 SV=2 29 272 2.0E-14
sp|Q6UX07|DHR13_HUMAN Dehydrogenase/reductase SDR family member 13 OS=Homo sapiens GN=DHRS13 PE=2 SV=1 11 321 4.0E-14
sp|Q96NR8|RDH12_HUMAN Retinol dehydrogenase 12 OS=Homo sapiens GN=RDH12 PE=1 SV=3 1 285 4.0E-14
sp|O74959|YJCD_SCHPO Uncharacterized oxidoreductase C736.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC736.13 PE=3 SV=1 29 246 1.0E-13
sp|Q5R9W5|WWOX_PONAB WW domain-containing oxidoreductase OS=Pongo abelii GN=WWOX PE=2 SV=1 27 303 2.0E-13
sp|Q9NZC7|WWOX_HUMAN WW domain-containing oxidoreductase OS=Homo sapiens GN=WWOX PE=1 SV=1 27 303 3.0E-13
sp|Q9ERI6|RDH14_MOUSE Retinol dehydrogenase 14 OS=Mus musculus GN=Rdh14 PE=1 SV=1 29 245 5.0E-13
sp|Q91WL8|WWOX_MOUSE WW domain-containing oxidoreductase OS=Mus musculus GN=Wwox PE=1 SV=1 27 315 3.0E-12
sp|Q803A8|WWOX_DANRE WW domain-containing oxidoreductase OS=Danio rerio GN=wwox PE=2 SV=1 22 292 8.0E-12
sp|Q8VBZ0|DHRSX_MOUSE Dehydrogenase/reductase SDR family member on chromosome X homolog OS=Mus musculus GN=Dhrsx PE=1 SV=2 18 310 1.0E-11
sp|O80333|POR_MARPA Protochlorophyllide reductase, chloroplastic OS=Marchantia paleacea GN=PORA PE=2 SV=1 18 241 2.0E-11
sp|Q53877|DNRU_STRS5 Putative daunorubicin C-13 ketoreductase DnrU OS=Streptomyces sp. (strain C5) PE=3 SV=1 1 308 3.0E-10
sp|Q9ZAU1|DNRU_STRPE Putative daunorubicin C-13 ketoreductase DnrU OS=Streptomyces peucetius GN=dnrU PE=3 SV=1 23 308 4.0E-10
sp|Q39617|POR_CHLRE Protochlorophyllide reductase, chloroplastic OS=Chlamydomonas reinhardtii GN=PORA PE=3 SV=1 30 241 1.0E-09
sp|Q05016|YM71_YEAST NADP-dependent 3-hydroxy acid dehydrogenase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR226C PE=1 SV=1 22 152 3.0E-09
sp|Q9P7B4|YI13_SCHPO NADP-dependent 3-hydroxy acid dehydrogenase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC521.03 PE=1 SV=1 25 152 4.0E-09
sp|Q42850|PORB_HORVU Protochlorophyllide reductase B, chloroplastic OS=Hordeum vulgare GN=PORB PE=2 SV=1 19 236 4.0E-09
sp|Q8W3D9|PORB_ORYSJ Protochlorophyllide reductase B, chloroplastic OS=Oryza sativa subsp. japonica GN=PORB PE=2 SV=1 18 236 5.0E-09
sp|Q42536|PORA_ARATH Protochlorophyllide reductase A, chloroplastic OS=Arabidopsis thaliana GN=PORA PE=1 SV=2 19 236 7.0E-09
sp|Q8N5I4|DHRSX_HUMAN Dehydrogenase/reductase SDR family member on chromosome X OS=Homo sapiens GN=DHRSX PE=2 SV=2 9 310 1.0E-08
sp|O66148|POR_LEPBY Light-dependent protochlorophyllide reductase OS=Leptolyngbya boryana GN=por PE=3 SV=2 31 315 1.0E-08
sp|Q9Y140|DHRS7_DROME Dehydrogenase/reductase SDR family protein 7-like OS=Drosophila melanogaster GN=CG7601 PE=2 SV=1 1 123 2.0E-08
sp|Q8T197|DHRS7_DICDI Dehydrogenase/reductase SDR family protein 7-like OS=Dictyostelium discoideum GN=DDB_G0274201 PE=3 SV=1 1 120 3.0E-07
sp|Q8N3Y7|RDHE2_HUMAN Epidermal retinol dehydrogenase 2 OS=Homo sapiens GN=SDR16C5 PE=2 SV=2 21 124 4.0E-07
sp|P16152|CBR1_HUMAN Carbonyl reductase [NADPH] 1 OS=Homo sapiens GN=CBR1 PE=1 SV=3 33 288 5.0E-07
sp|Q8K354|CBR3_MOUSE Carbonyl reductase [NADPH] 3 OS=Mus musculus GN=Cbr3 PE=1 SV=1 33 288 6.0E-07
sp|P21218|PORB_ARATH Protochlorophyllide reductase B, chloroplastic OS=Arabidopsis thaliana GN=PORB PE=1 SV=3 31 236 6.0E-07
sp|A6QP05|DHR12_BOVIN Dehydrogenase/reductase SDR family member 12 OS=Bos taurus GN=DHRS12 PE=2 SV=1 29 274 7.0E-07
sp|Q5RCU5|CBR1_PONAB Carbonyl reductase [NADPH] 1 OS=Pongo abelii GN=CBR1 PE=2 SV=3 33 288 8.0E-07
sp|O48741|PORC_ARATH Protochlorophyllide reductase C, chloroplastic OS=Arabidopsis thaliana GN=PORC PE=1 SV=1 19 236 9.0E-07
sp|Q05A13|S16C6_MOUSE Short-chain dehydrogenase/reductase family 16C member 6 OS=Mus musculus GN=Sdr16c6 PE=2 SV=1 7 154 1.0E-06
sp|Q8MI29|CBR1_MACFA Carbonyl reductase [NADPH] 1 OS=Macaca fascicularis GN=CBR1 PE=2 SV=1 33 288 2.0E-06
sp|Q41249|PORA_CUCSA Protochlorophyllide reductase, chloroplastic OS=Cucumis sativus GN=PORA PE=2 SV=1 21 236 2.0E-06
sp|O54438|FABG_PSEAE 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=fabG PE=1 SV=1 27 245 2.0E-06
sp|Q9SDT1|POR_DAUCA Protochlorophyllide reductase, chloroplastic OS=Daucus carota GN=POR1 PE=2 SV=1 31 121 3.0E-06
sp|Q7TQA3|RDHE2_MOUSE Epidermal retinol dehydrogenase 2 OS=Mus musculus GN=Sdr16c5 PE=2 SV=1 22 124 4.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3403
MPVPLPFLGGFLYRQLLITPPKPKSRFDGQTIIVTGSNVGLGLEAARHFGRLGAARIILAVRDVEKGEAAKKSID
RSLSRVPSPVTVWKLDLSSYDSVLEFAARTERELDRIDVVCENAGIATGCFRITEKDESSITTNVVSTFLLAFLV
LPKLKETAQRFNTRPRLVITGSEAHMFATFAERNEPEIFAALSDKTKANMLERYFVSKLIQLLVVREMAARAGAS
YPVTINCTNPGFCHSELARESGWYLYIMGLLLARSTEVGSRTIVAAAEAGPETHGKYMSESYVIEPSDFVTSEEG
ARVQTKIWSELVDKMEAIKPGVTGNL
Coding >Ophio5|3403
ATGCCCGTCCCTCTCCCCTTTCTCGGCGGCTTCCTCTACCGCCAGCTCTTGATTACACCTCCAAAGCCCAAGAGC
CGATTCGACGGCCAAACCATTATTGTCACCGGCTCCAACGTAGGTCTCGGGCTTGAAGCTGCCCGCCACTTCGGT
CGTCTTGGAGCTGCGCGCATCATCCTCGCAGTCCGCGACGTTGAAAAGGGAGAGGCAGCGAAAAAGTCCATCGAC
CGATCCCTAAGCCGCGTGCCGTCTCCCGTGACAGTTTGGAAGCTTGACCTCTCCAGCTATGATAGCGTGCTAGAG
TTTGCAGCGCGTACGGAAAGGGAGCTCGATCGTATCGATGTCGTTTGCGAAAATGCGGGCATTGCAACAGGATGC
TTCCGTATAACGGAAAAAGATGAGAGCTCCATCACTACCAACGTCGTCAGCACGTTTCTGCTCGCTTTCTTGGTT
TTACCCAAGCTCAAAGAGACGGCACAACGATTCAACACGCGTCCAAGGCTAGTTATCACCGGAAGCGAGGCCCAC
ATGTTCGCCACCTTCGCGGAGAGGAATGAACCTGAGATATTCGCTGCGCTTTCCGACAAGACAAAAGCCAATATG
CTCGAACGTTATTTCGTCAGCAAACTGATTCAACTTCTCGTCGTCCGCGAGATGGCTGCTCGTGCAGGGGCCTCG
TACCCAGTCACAATCAACTGCACCAACCCAGGGTTCTGCCACTCGGAGTTGGCGAGGGAGTCAGGATGGTATTTG
TACATCATGGGGTTATTGTTGGCACGCTCAACCGAGGTCGGCAGCCGCACCATCGTTGCAGCTGCGGAGGCCGGT
CCGGAGACACATGGCAAGTACATGAGCGAGAGCTATGTGATAGAGCCTAGCGACTTCGTGACGAGCGAGGAGGGA
GCACGAGTGCAAACTAAGATATGGTCCGAGTTGGTGGACAAGATGGAGGCTATTAAGCCGGGTGTTACGGGAAAC
CTC
Transcript >Ophio5|3403
ATGCCCGTCCCTCTCCCCTTTCTCGGCGGCTTCCTCTACCGCCAGCTCTTGATTACACCTCCAAAGCCCAAGAGC
CGATTCGACGGCCAAACCATTATTGTCACCGGCTCCAACGTAGGTCTCGGGCTTGAAGCTGCCCGCCACTTCGGT
CGTCTTGGAGCTGCGCGCATCATCCTCGCAGTCCGCGACGTTGAAAAGGGAGAGGCAGCGAAAAAGTCCATCGAC
CGATCCCTAAGCCGCGTGCCGTCTCCCGTGACAGTTTGGAAGCTTGACCTCTCCAGCTATGATAGCGTGCTAGAG
TTTGCAGCGCGTACGGAAAGGGAGCTCGATCGTATCGATGTCGTTTGCGAAAATGCGGGCATTGCAACAGGATGC
TTCCGTATAACGGAAAAAGATGAGAGCTCCATCACTACCAACGTCGTCAGCACGTTTCTGCTCGCTTTCTTGGTT
TTACCCAAGCTCAAAGAGACGGCACAACGATTCAACACGCGTCCAAGGCTAGTTATCACCGGAAGCGAGGCCCAC
ATGTTCGCCACCTTCGCGGAGAGGAATGAACCTGAGATATTCGCTGCGCTTTCCGACAAGACAAAAGCCAATATG
CTCGAACGTTATTTCGTCAGCAAACTGATTCAACTTCTCGTCGTCCGCGAGATGGCTGCTCGTGCAGGGGCCTCG
TACCCAGTCACAATCAACTGCACCAACCCAGGGTTCTGCCACTCGGAGTTGGCGAGGGAGTCAGGATGGTATTTG
TACATCATGGGGTTATTGTTGGCACGCTCAACCGAGGTCGGCAGCCGCACCATCGTTGCAGCTGCGGAGGCCGGT
CCGGAGACACATGGCAAGTACATGAGCGAGAGCTATGTGATAGAGCCTAGCGACTTCGTGACGAGCGAGGAGGGA
GCACGAGTGCAAACTAAGATATGGTCCGAGTTGGTGGACAAGATGGAGGCTATTAAGCCGGGTGTTACGGGAAAC
CTCTAA
Gene >Ophio5|3403
ATGCCCGTCCCTCTCCCCTTTCTCGGCGGCTTCCTCTACCGCCAGCTCTTGATTACACCTCCAAAGCCCAAGAGC
CGATTCGACGGCCAAACCATTATTGTCACCGGCTCCAACGTAGGTCTCGGGCTTGAAGCTGCCCGCCACTTCGGT
CGTCTTGGAGCTGCGCGCATCATCCTCGCAGTCCGCGACGTTGAAAAGGGAGAGGCAGCGAAAAAGTCCATCGAC
CGATCCCTAAGCCGCGTGCCGTCTCCCGTGACAGTTTGGAAGCTTGACCTCTCCAGCTATGATAGCGTGCTAGAG
TTTGCAGCGCGTACGGAAAGGGAGCTCGATCGTATCGATGTCGTTTGCGAAAATGCGGGCATTGCAACAGGATGC
TTCCGTATAACGGAAAAAGATGAGAGCTCCATCACTACCAACGTCGTCAGCACGTTTCTGCTCGCTTTCTTGGTT
TTACCCAAGCTCAAAGAGACGGCACAACGATTCAACACGCGTCCAAGGCTAGTTATCACCGGAAGCGAGGCCGTG
AGTATTCTATCCCCAACCCGTAACACGCTTCTCTCTTCTAAGCTGATGACGACTTTGCAGCACATGTTCGCCACC
TTCGCGGAGAGGAATGAACCTGAGATATTCGCTGCGCTTTCCGACAAGACAAAAGCCAATATGCTCGAACGTTAT
TTCGTCAGCAAACTGATTCAACTTCTCGTCGTCCGCGAGATGGCTGCTCGTGCAGGGGCCTCGTACCCAGTCACA
ATCAACTGCACCAACCCAGGGTTCTGCCACTCGGAGTTGGCGAGGGAGTCAGGATGGTATTTGTACATCATGGGG
TTATTGTTGGCACGCTCAACCGAGGTCGGCAGCCGCACCATCGTTGCAGCTGCGGAGGCCGGTCCGGAGACACAT
GGCAAGTACATGAGCGAGAGCTATGTGATAGAGCCTAGCGACTTCGTGACGAGCGAGGAGGGAGCACGAGTGCAA
ACTAAGATATGGTCCGAGTTGGTGGACAAGATGGAGGCTATTAAGCCGGGTGTTACGGGAAACCTCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail