Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3400
Gene name
Locationscaffold_27:38537..39658
Strand+
Gene length (bp)1121
Transcript length (bp)960
Coding sequence length (bp)957
Protein length (aa) 319

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04116 FA_hydroxylase Fatty acid hydroxylase 4.2E-23 173 306

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38992|SUR2_YEAST Sphingolipid C4-hydroxylase SUR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SUR2 PE=1 SV=1 2 318 1.0E-53
sp|O94298|SUR2_SCHPO Sphingolipid C4-hydroxylase sur2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sur2 PE=3 SV=1 21 306 2.0E-50
sp|Q9AST3|SBH2_ARATH Sphinganine C4-monooxygenase 2 OS=Arabidopsis thaliana GN=SBH2 PE=1 SV=1 17 306 1.0E-40
sp|Q8VYI1|SBH1_ARATH Sphinganine C4-monooxygenase 1 OS=Arabidopsis thaliana GN=SBH1 PE=1 SV=1 162 306 5.0E-29
sp|Q5R574|MSMO1_PONAB Methylsterol monooxygenase 1 OS=Pongo abelii GN=MSMO1 PE=2 SV=1 177 318 5.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38992|SUR2_YEAST Sphingolipid C4-hydroxylase SUR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SUR2 PE=1 SV=1 2 318 1.0E-53
sp|O94298|SUR2_SCHPO Sphingolipid C4-hydroxylase sur2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sur2 PE=3 SV=1 21 306 2.0E-50
sp|Q9AST3|SBH2_ARATH Sphinganine C4-monooxygenase 2 OS=Arabidopsis thaliana GN=SBH2 PE=1 SV=1 17 306 1.0E-40
sp|Q8VYI1|SBH1_ARATH Sphinganine C4-monooxygenase 1 OS=Arabidopsis thaliana GN=SBH1 PE=1 SV=1 162 306 5.0E-29
sp|Q5R574|MSMO1_PONAB Methylsterol monooxygenase 1 OS=Pongo abelii GN=MSMO1 PE=2 SV=1 177 318 5.0E-13
sp|Q15800|MSMO1_HUMAN Methylsterol monooxygenase 1 OS=Homo sapiens GN=MSMO1 PE=1 SV=1 177 318 5.0E-13
sp|Q6UGB2|MSMO1_PIG Methylsterol monooxygenase 1 OS=Sus scrofa GN=MSMO1 PE=2 SV=1 177 318 1.0E-12
sp|Q5ZLL6|MSMO1_CHICK Methylsterol monooxygenase 1 OS=Gallus gallus GN=MSMO1 PE=2 SV=1 177 319 1.0E-12
sp|Q9CRA4|MSMO1_MOUSE Methylsterol monooxygenase 1 OS=Mus musculus GN=Msmo1 PE=1 SV=1 177 306 2.0E-12
sp|Q4R4Q4|MSMO1_MACFA Methylsterol monooxygenase 1 OS=Macaca fascicularis GN=MSMO1 PE=2 SV=1 177 306 3.0E-12
sp|O35532|MSMO1_RAT Methylsterol monooxygenase 1 OS=Rattus norvegicus GN=Msmo1 PE=2 SV=1 177 306 4.0E-12
sp|Q5PRC0|CH25H_DANRE Cholesterol 25-hydroxylase-like protein OS=Danio rerio GN=ch25h PE=2 SV=1 166 307 5.0E-12
sp|Q7ZW77|MSMO1_DANRE Methylsterol monooxygenase 1 OS=Danio rerio GN=msmo1 PE=2 SV=1 177 312 2.0E-11
sp|Q1LX59|C2512_DANRE Cholesterol 25-hydroxylase-like protein 1, member 2 OS=Danio rerio GN=ch25hl1.2 PE=3 SV=1 175 306 5.0E-11
sp|Q9UUH4|MSMO_SCHPO Methylsterol monooxygenase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erg25 PE=3 SV=1 128 318 5.0E-11
sp|Q55D54|MSMOB_DICDI Putative methylsterol monooxygenase DDB_G0269788 OS=Dictyostelium discoideum GN=DDB_G0269788 PE=3 SV=1 177 318 3.0E-10
sp|Q8L7W5|SMO11_ARATH Methylsterol monooxygenase 1-1 OS=Arabidopsis thaliana GN=SMO1-1 PE=1 SV=1 170 306 3.0E-10
sp|Q9ZW22|SMO21_ARATH Methylsterol monooxygenase 2-1 OS=Arabidopsis thaliana GN=SMO2-1 PE=2 SV=2 186 306 9.0E-10
sp|Q1EC69|SMO12_ARATH Methylsterol monooxygenase 1-2 OS=Arabidopsis thaliana GN=SMO1-2 PE=2 SV=1 166 306 1.0E-09
sp|Q8VWZ8|SMO22_ARATH Methylsterol monooxygenase 2-2 OS=Arabidopsis thaliana GN=SMO2-2 PE=2 SV=1 186 306 2.0E-09
sp|A8WGT1|C25L2_DANRE Cholesterol 25-hydroxylase-like protein 2 OS=Danio rerio GN=ch25hl2 PE=2 SV=1 183 319 2.0E-09
sp|P53045|MSMO_YEAST Methylsterol monooxygenase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERG25 PE=1 SV=1 177 319 2.0E-09
sp|Q567X1|C25L1_DANRE Cholesterol 25-hydroxylase-like protein 1, member 1 OS=Danio rerio GN=ch25hl1.1 PE=2 SV=2 174 306 4.0E-09
sp|Q55D52|MSMOA_DICDI Putative methylsterol monooxygenase DDB_G0270946 OS=Dictyostelium discoideum GN=DDB_G0270946 PE=3 SV=2 177 319 5.0E-09
sp|Q4G1G8|CH25H_PIG Cholesterol 25-hydroxylase OS=Sus scrofa GN=CH25H PE=2 SV=1 170 307 5.0E-09
sp|Q4QQV7|CH25H_RAT Cholesterol 25-hydroxylase OS=Rattus norvegicus GN=Ch25h PE=2 SV=1 173 307 7.0E-09
sp|Q9Z0F5|CH25H_MOUSE Cholesterol 25-hydroxylase OS=Mus musculus GN=Ch25h PE=1 SV=1 173 307 1.0E-08
sp|F4JLZ6|SMO13_ARATH Methylsterol monooxygenase 1-3 OS=Arabidopsis thaliana GN=SMO1-3 PE=2 SV=1 183 306 3.0E-08
sp|O59933|MSMO_CANAL Methylsterol monooxygenase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ERG25 PE=3 SV=1 177 319 4.0E-08
sp|O95992|CH25H_HUMAN Cholesterol 25-hydroxylase OS=Homo sapiens GN=CH25H PE=1 SV=1 183 314 3.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0005506 iron ion binding Yes
GO:0016491 oxidoreductase activity Yes
GO:0008610 lipid biosynthetic process Yes
GO:0008152 metabolic process No
GO:0005488 binding No
GO:0009058 biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0046872 metal ion binding No
GO:0046914 transition metal ion binding No
GO:0044238 primary metabolic process No
GO:0006629 lipid metabolic process No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0008150 biological_process No
GO:1901576 organic substance biosynthetic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Endoplasmic reticulum Signal peptide|Transmembrane domain 0.1033 0.0889 0.0128 0.1142 0.2828 0.0561 0.9542 0.1963 0.2753 0.005

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 69 91 22
2 163 185 22
3 222 241 19

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

Gene cluster ID Type of secondary metabolism gene
Cluster 10 (None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4739
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1269
Ophiocordyceps australis 1348a (Ghana) OphauG2|157
Ophiocordyceps australis map64 (Brazil) OphauB2|2580
Ophiocordyceps australis map64 (Brazil) OphauB2|2582
Ophiocordyceps kimflemingae Ophio5|3398
Ophiocordyceps kimflemingae Ophio5|3400 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3400
MAEQLVLRPKPPLIPWISDYNLSLIVPVVTHWTTAALYGLIERFELFQEYRIHTRDEERVKNRISRRKCLRGVIL
VQLLQTGFGIALGMFSGVEMTGNEDHEVMKWASRVHNFGRTLTCYFPYDGSKVDMAQTTLQGLVDSTFLTSSLVE
FQADLFVAKVIFYALMPACRLYLALWLADAWVFFIHRAEHRNAWLYRNFHARHHELYVPYSWGGIYDHPFESLFL
SVGAFAIAVLGTGMTLRESILFSAFSSAKACTDHGGYKFPWNPMDLFTSVDAEYHDKHHQRRGLKTNFALHFQFW
DRMFGTVFKGNEAAAKKQD
Coding >Ophio5|3400
ATGGCTGAACAACTTGTCCTCCGTCCAAAACCACCGCTTATTCCTTGGATATCCGACTATAATCTTTCCTTGATT
GTTCCCGTAGTGACTCATTGGACTACCGCGGCCCTCTACGGACTTATTGAGCGCTTTGAACTTTTCCAAGAATAT
CGGATTCATACGCGCGATGAGGAAAGAGTTAAAAATAGGATCAGCCGACGAAAGTGCCTTCGCGGTGTCATCTTA
GTCCAGCTCTTGCAGACCGGCTTTGGCATCGCTTTGGGCATGTTCTCAGGCGTAGAGATGACAGGCAATGAGGAT
CACGAGGTCATGAAATGGGCAAGTCGTGTGCACAATTTTGGGCGCACGCTGACTTGCTATTTTCCCTATGATGGC
TCTAAAGTCGACATGGCTCAAACGACGCTTCAAGGCTTGGTCGATTCTACATTTCTCACTTCCTCTTTGGTGGAA
TTTCAGGCAGACTTGTTCGTCGCCAAGGTCATCTTCTACGCACTGATGCCTGCGTGTCGATTATACCTCGCCTTG
TGGCTTGCGGATGCGTGGGTATTCTTTATTCATCGCGCCGAGCACAGAAATGCATGGTTATATAGGAACTTCCAC
GCGCGCCATCACGAGTTGTACGTCCCGTACAGCTGGGGAGGGATCTATGACCACCCCTTTGAGAGCTTGTTTCTC
AGTGTCGGGGCCTTTGCAATCGCTGTTCTTGGCACCGGGATGACGTTGAGAGAAAGCATACTCTTTTCAGCCTTT
TCCTCCGCCAAAGCTTGCACAGATCATGGCGGATACAAGTTTCCTTGGAATCCGATGGATCTATTCACATCAGTC
GACGCTGAGTATCATGACAAACACCATCAACGAAGAGGTTTAAAGACCAACTTTGCTCTTCACTTTCAGTTCTGG
GATCGAATGTTTGGAACTGTGTTCAAGGGGAACGAAGCTGCAGCGAAGAAACAGGAC
Transcript >Ophio5|3400
ATGGCTGAACAACTTGTCCTCCGTCCAAAACCACCGCTTATTCCTTGGATATCCGACTATAATCTTTCCTTGATT
GTTCCCGTAGTGACTCATTGGACTACCGCGGCCCTCTACGGACTTATTGAGCGCTTTGAACTTTTCCAAGAATAT
CGGATTCATACGCGCGATGAGGAAAGAGTTAAAAATAGGATCAGCCGACGAAAGTGCCTTCGCGGTGTCATCTTA
GTCCAGCTCTTGCAGACCGGCTTTGGCATCGCTTTGGGCATGTTCTCAGGCGTAGAGATGACAGGCAATGAGGAT
CACGAGGTCATGAAATGGGCAAGTCGTGTGCACAATTTTGGGCGCACGCTGACTTGCTATTTTCCCTATGATGGC
TCTAAAGTCGACATGGCTCAAACGACGCTTCAAGGCTTGGTCGATTCTACATTTCTCACTTCCTCTTTGGTGGAA
TTTCAGGCAGACTTGTTCGTCGCCAAGGTCATCTTCTACGCACTGATGCCTGCGTGTCGATTATACCTCGCCTTG
TGGCTTGCGGATGCGTGGGTATTCTTTATTCATCGCGCCGAGCACAGAAATGCATGGTTATATAGGAACTTCCAC
GCGCGCCATCACGAGTTGTACGTCCCGTACAGCTGGGGAGGGATCTATGACCACCCCTTTGAGAGCTTGTTTCTC
AGTGTCGGGGCCTTTGCAATCGCTGTTCTTGGCACCGGGATGACGTTGAGAGAAAGCATACTCTTTTCAGCCTTT
TCCTCCGCCAAAGCTTGCACAGATCATGGCGGATACAAGTTTCCTTGGAATCCGATGGATCTATTCACATCAGTC
GACGCTGAGTATCATGACAAACACCATCAACGAAGAGGTTTAAAGACCAACTTTGCTCTTCACTTTCAGTTCTGG
GATCGAATGTTTGGAACTGTGTTCAAGGGGAACGAAGCTGCAGCGAAGAAACAGGACTAG
Gene >Ophio5|3400
ATGGCTGAACAACTTGTCCTCCGTCCAAAACCACCGCTTATTCCTTGGATATCCGACTATAATCTTTCCTTGATT
GTTCCCGTAGTGACTCATTGGACTACCGCGGCCCTCTACGGACTTATTGAGCGCTTTGAACTTTTCCAAGAATAT
CGGATTCATACGCGCGATGAGGAAAGAGTTAAAAATAGGATCAGCCGACGAAAGTGCCTTCGCGGTGTCATCTTA
GTCCAGGTGTGCAAAGCCTTGTTTTCTCGGCTGACAATATCTCTGATATCTGAAGTGCAGCTCTTGCAGACCGGC
TTTGGCATCGCTTTGGGCATGTTCTCAGGCGTAGAGATGACAGGCAATGAGGATCACGAGGTCATGAAATGGGCA
AGTCGTGTGCACAATTTTGGGCGCACGCTGACTTGCTATTTTCCCTATGATGGCTCTAAAGTCGACATGGCTCAA
ACGACGCTTCAAGGCTTGGTCGATTCTACATTTCTCACTTCCTCTTTGGTGGAATTTCAGGCAGACTTGTTCGTC
GCCAAGGTCATCTTCTACGCACTGATGCCTGCGTGTCGATTATACCTCGCCTTGTGGCTTGCGGATGCGTGGGTA
TTCTTTATTCATCGCGCCGAGCACAGAAATGCATGGTTATATAGTAAGTGGAATGAAGCACAGCAAAGGGACCCC
CCCTGACGCCATGACCTAGGGAACTTCCACGCGCGCCATCACGAGTTGTACGTCCCGTACAGCTGGGGAGGGATC
TATGACCACCCCTTTGAGAGCTTGTTTCTCAGTGTCGGGGCCTTTGCAATCGCTGTTCTTGGCACCGGGATGACG
TTGAGAGAAAGCATACTCTTTTCAGCCTTTTCCTCCGCCAAAGCTTGCACAGATCATGGCGGATACAAGTTTCCT
TGGAATCCGATGGATCTATTCACATCAGTCGACGCTGAGTATCATGACAAACACCATCAACGAAGAGGTTTAAAG
GTAATTCCACTTGTATATTTTTTTTTTCGACTACTTCGCCCTAACAGTGATAATAGACCAACTTTGCTCTTCACT
TTCAGTTCTGGGATCGAATGTTTGGAACTGTGTTCAAGGGGAACGAAGCTGCAGCGAAGAAACAGGACTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail