Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|34
Gene name
Locationscaffold_1:81536..82682
Strand-
Gene length (bp)1146
Transcript length (bp)1146
Coding sequence length (bp)1143
Protein length (aa) 381

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07479 NAD_Gly3P_dh_C NAD-dependent glycerol-3-phosphate dehydrogenase C-terminus 1.3E-41 225 371
PF01210 NAD_Gly3P_dh_N NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus 3.8E-32 24 148

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6UGN0|GPD_HYPAT Glycerol-3-phosphate dehydrogenase [NAD(+)] OS=Hypocrea atroviridis GN=gld1 PE=3 SV=1 1 376 0.0E+00
sp|Q7Z8E7|GPD_COLGL Glycerol-3-phosphate dehydrogenase [NAD(+)] OS=Colletotrichum gloeosporioides PE=2 SV=1 1 376 0.0E+00
sp|L7IGD3|GPD_MAGOY Glycerol-3-phosphate dehydrogenase [NAD(+)] OS=Magnaporthe oryzae (strain Y34) GN=OOU_Y34scaffold00217g6 PE=2 SV=1 1 375 2.0E-172
sp|P0CT11|GPD_MAGO7 Glycerol-3-phosphate dehydrogenase [NAD(+)] OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_00067 PE=3 SV=1 1 375 2.0E-172
sp|Q7ZA43|GPD_PICAN Glycerol-3-phosphate dehydrogenase [NAD(+)] OS=Pichia angusta GN=GPD PE=3 SV=1 1 375 4.0E-104
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6UGN0|GPD_HYPAT Glycerol-3-phosphate dehydrogenase [NAD(+)] OS=Hypocrea atroviridis GN=gld1 PE=3 SV=1 1 376 0.0E+00
sp|Q7Z8E7|GPD_COLGL Glycerol-3-phosphate dehydrogenase [NAD(+)] OS=Colletotrichum gloeosporioides PE=2 SV=1 1 376 0.0E+00
sp|L7IGD3|GPD_MAGOY Glycerol-3-phosphate dehydrogenase [NAD(+)] OS=Magnaporthe oryzae (strain Y34) GN=OOU_Y34scaffold00217g6 PE=2 SV=1 1 375 2.0E-172
sp|P0CT11|GPD_MAGO7 Glycerol-3-phosphate dehydrogenase [NAD(+)] OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_00067 PE=3 SV=1 1 375 2.0E-172
sp|Q7ZA43|GPD_PICAN Glycerol-3-phosphate dehydrogenase [NAD(+)] OS=Pichia angusta GN=GPD PE=3 SV=1 1 375 4.0E-104
sp|Q00055|GPD1_YEAST Glycerol-3-phosphate dehydrogenase [NAD(+)] 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GPD1 PE=1 SV=4 1 379 6.0E-103
sp|Q6J5J3|GPD1_SACUV Glycerol-3-phosphate dehydrogenase [NAD(+)] 1 OS=Saccharomyces uvarum GN=GPD1 PE=3 SV=1 1 379 6.0E-103
sp|Q9UVF4|GPD1_YARLI Glycerol-3-phosphate dehydrogenase [NAD(+)] 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=GPD1 PE=3 SV=1 26 375 1.0E-102
sp|Q759G5|GPD_ASHGO Glycerol-3-phosphate dehydrogenase [NAD(+)] OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=GPD PE=3 SV=1 1 375 8.0E-102
sp|P41911|GPD2_YEAST Glycerol-3-phosphate dehydrogenase [NAD(+)] 2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GPD2 PE=1 SV=2 1 381 8.0E-100
sp|Q6ZZF4|GPD1_CYBJA Glycerol-3-phosphate dehydrogenase [NAD(+)] 1 OS=Cyberlindnera jadinii GN=gpd1 PE=3 SV=1 1 375 1.0E-98
sp|Q9HGY1|GPD2_ZYGRO Glycerol-3-phosphate dehydrogenase [NAD(+)] 2 OS=Zygosaccharomyces rouxii GN=GPD2 PE=2 SV=1 1 379 4.0E-98
sp|Q6FN96|GPD1_CANGA Glycerol-3-phosphate dehydrogenase [NAD(+)] 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=GPD1 PE=3 SV=1 1 375 7.0E-98
sp|Q6FWJ7|GPD2_CANGA Glycerol-3-phosphate dehydrogenase [NAD(+)] 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=GPD2 PE=3 SV=1 1 380 2.0E-97
sp|Q4PNS1|GPD_CANTR Glycerol-3-phosphate dehydrogenase [NAD(+)] OS=Candida tropicalis GN=GPD PE=3 SV=1 1 375 5.0E-97
sp|Q6ZYA7|GPD2_CYBJA Glycerol-3-phosphate dehydrogenase [NAD(+)] 2 OS=Cyberlindnera jadinii GN=gpd2 PE=3 SV=2 1 375 9.0E-97
sp|Q9HGY2|GPD1_ZYGRO Glycerol-3-phosphate dehydrogenase [NAD(+)] 1 OS=Zygosaccharomyces rouxii GN=GPD1 PE=3 SV=1 1 381 4.0E-96
sp|P21696|GPD1_SCHPO Glycerol-3-phosphate dehydrogenase [NAD(+)] 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gpd1 PE=1 SV=2 1 361 3.0E-91
sp|Q7ZA45|GPD_LACTH Glycerol-3-phosphate dehydrogenase [NAD(+)] OS=Lachancea thermotolerans GN=GPD PE=3 SV=1 1 331 6.0E-91
sp|Q09845|GPD2_SCHPO Glycerol-3-phosphate dehydrogenase [NAD(+)] 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gpd2 PE=1 SV=1 1 362 7.0E-88
sp|Q5EA88|GPDA_BOVIN Glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic OS=Bos taurus GN=GPD1 PE=2 SV=3 1 361 9.0E-87
sp|Q5RCE0|GPDA_PONAB Glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic OS=Pongo abelii GN=GPD1 PE=2 SV=3 1 375 1.0E-86
sp|O35077|GPDA_RAT Glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic OS=Rattus norvegicus GN=Gpd1 PE=1 SV=4 1 361 7.0E-86
sp|P13707|GPDA_MOUSE Glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic OS=Mus musculus GN=Gpd1 PE=1 SV=3 1 375 8.0E-86
sp|P21695|GPDA_HUMAN Glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic OS=Homo sapiens GN=GPD1 PE=1 SV=4 1 361 1.0E-85
sp|Q801R8|GPD1L_XENLA Glycerol-3-phosphate dehydrogenase 1-like protein OS=Xenopus laevis GN=gpd1l PE=2 SV=1 1 371 5.0E-85
sp|Q6P824|GPD1L_XENTR Glycerol-3-phosphate dehydrogenase 1-like protein OS=Xenopus tropicalis GN=gpd1l PE=2 SV=1 1 371 3.0E-83
sp|P08507|GPDA_RABIT Glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic OS=Oryctolagus cuniculus GN=GPD1 PE=3 SV=2 1 375 9.0E-81
sp|Q3ULJ0|GPD1L_MOUSE Glycerol-3-phosphate dehydrogenase 1-like protein OS=Mus musculus GN=Gpd1l PE=1 SV=2 1 361 6.0E-80
sp|Q5XIZ6|GPD1L_DANRE Glycerol-3-phosphate dehydrogenase 1-like protein OS=Danio rerio GN=gpd1l PE=2 SV=1 1 371 8.0E-79
sp|Q8N335|GPD1L_HUMAN Glycerol-3-phosphate dehydrogenase 1-like protein OS=Homo sapiens GN=GPD1L PE=1 SV=1 1 371 9.0E-79
sp|Q5R5V3|GPD1L_PONAB Glycerol-3-phosphate dehydrogenase 1-like protein OS=Pongo abelii GN=GPD1L PE=2 SV=1 1 361 3.0E-78
sp|O57656|GPDA_TAKRU Glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic OS=Takifugu rubripes GN=gpd1 PE=3 SV=1 1 361 1.0E-76
sp|P52425|GPDA_CUPLA Glycerol-3-phosphate dehydrogenase [NAD(+)] OS=Cuphea lanceolata GN=GPDH PE=2 SV=1 1 365 9.0E-73
sp|P34517|GPDH2_CAEEL Probable glycerol-3-phosphate dehydrogenase 2 OS=Caenorhabditis elegans GN=gpdh-2 PE=3 SV=2 1 367 1.0E-66
sp|Q27567|GPDA_DROEZ Glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic OS=Drosophila ezoana GN=Gpdh1 PE=3 SV=4 26 371 1.0E-64
sp|P13706|GPDA_DROME Glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic OS=Drosophila melanogaster GN=Gpdh PE=1 SV=3 26 371 3.0E-64
sp|O97463|GPDA_DROKA Glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic OS=Drosophila kanekoi GN=Gpdh1 PE=3 SV=3 26 371 4.0E-64
sp|Q27556|GPDA_DROAE Glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic OS=Drosophila americana GN=Gpdh PE=3 SV=4 26 371 5.0E-64
sp|P07735|GPDA_DROVI Glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic OS=Drosophila virilis GN=Gpdh PE=1 SV=3 26 371 7.0E-64
sp|Q27928|GPDA_DROPS Glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic OS=Drosophila pseudoobscura pseudoobscura GN=Gpdh PE=3 SV=2 26 371 4.0E-63
sp|Q9SCX9|GPDA1_ARATH Glycerol-3-phosphate dehydrogenase [NAD(+)] 1, chloroplastic OS=Arabidopsis thaliana GN=DHAPRD PE=1 SV=1 212 371 4.0E-36
sp|Q9SCX9|GPDA1_ARATH Glycerol-3-phosphate dehydrogenase [NAD(+)] 1, chloroplastic OS=Arabidopsis thaliana GN=DHAPRD PE=1 SV=1 1 146 1.0E-29
sp|A9VMB4|GPDA_BACWK Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Bacillus weihenstephanensis (strain KBAB4) GN=gpsA PE=3 SV=1 22 370 4.0E-29
sp|B7IP83|GPDA_BACC2 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Bacillus cereus (strain G9842) GN=gpsA PE=3 SV=1 17 370 7.0E-29
sp|A7GN42|GPDA_BACCN Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=gpsA PE=3 SV=1 22 370 3.0E-28
sp|Q81FR4|GPDA_BACCR Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=gpsA PE=3 SV=1 22 370 9.0E-28
sp|B7HHQ8|GPDA_BACC4 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Bacillus cereus (strain B4264) GN=gpsA PE=3 SV=1 22 370 9.0E-28
sp|Q81SW8|GPDA_BACAN Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Bacillus anthracis GN=gpsA PE=3 SV=1 17 370 8.0E-26
sp|C3L9F3|GPDA_BACAC Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=gpsA PE=3 SV=1 17 370 8.0E-26
sp|C3P592|GPDA_BACAA Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Bacillus anthracis (strain A0248) GN=gpsA PE=3 SV=1 17 370 8.0E-26
sp|Q6HL50|GPDA_BACHK Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=gpsA PE=3 SV=1 17 370 1.0E-25
sp|Q63DM7|GPDA_BACCZ Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Bacillus cereus (strain ZK / E33L) GN=gpsA PE=3 SV=1 17 370 1.0E-25
sp|C1EN02|GPDA_BACC3 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Bacillus cereus (strain 03BB102) GN=gpsA PE=3 SV=1 17 370 1.0E-25
sp|B7JGZ0|GPDA_BACC0 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Bacillus cereus (strain AH820) GN=gpsA PE=3 SV=1 17 370 1.0E-25
sp|A0RBW0|GPDA_BACAH Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Bacillus thuringiensis (strain Al Hakam) GN=gpsA PE=3 SV=1 17 370 1.0E-25
sp|B9IVM7|GPDA_BACCQ Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Bacillus cereus (strain Q1) GN=gpsA PE=3 SV=1 17 370 2.0E-25
sp|B7HL15|GPDA_BACC7 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Bacillus cereus (strain AH187) GN=gpsA PE=3 SV=1 17 370 2.0E-25
sp|P61737|GPDA_BACC1 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=gpsA PE=3 SV=1 17 370 2.0E-25
sp|Q65I16|GPDA_BACLD Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=gpsA PE=3 SV=1 16 369 3.0E-25
sp|B1HT97|GPDA_LYSSC Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Lysinibacillus sphaericus (strain C3-41) GN=gpsA PE=3 SV=1 32 362 5.0E-25
sp|Q0AXC3|GPDA_SYNWW Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=gpsA PE=3 SV=1 14 373 7.0E-25
sp|Q1GWP9|GPDA2_SPHAL Glycerol-3-phosphate dehydrogenase [NAD(P)+] 2 OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=gpsA2 PE=3 SV=1 32 373 1.0E-23
sp|Q47S98|GPDA_THEFY Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Thermobifida fusca (strain YX) GN=gpsA PE=3 SV=1 22 358 7.0E-23
sp|B3EPU7|GPDA_CHLPB Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Chlorobium phaeobacteroides (strain BS1) GN=gpsA PE=3 SV=1 36 362 8.0E-23
sp|Q5KXT1|GPDA_GEOKA Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Geobacillus kaustophilus (strain HTA426) GN=gpsA PE=3 SV=1 16 376 2.0E-22
sp|Q834C1|GPDA_ENTFA Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=gpsA PE=3 SV=1 22 379 2.0E-22
sp|B9DNV8|GPDA_STACT Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Staphylococcus carnosus (strain TM300) GN=gpsA PE=3 SV=1 22 375 8.0E-22
sp|Q93FD0|GPDA1_LACDA Glycerol-3-phosphate dehydrogenase [NAD(P)+] 1 OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=gpsA1 PE=3 SV=1 189 375 2.0E-21
sp|A8FEL7|GPDA_BACP2 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Bacillus pumilus (strain SAFR-032) GN=gpsA PE=3 SV=1 212 370 4.0E-21
sp|A4IQA1|GPDA_GEOTN Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Geobacillus thermodenitrificans (strain NG80-2) GN=gpsA PE=3 SV=1 32 343 5.0E-21
sp|Q5FL70|GPDA_LACAC Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=gpsA PE=3 SV=1 212 362 6.0E-21
sp|B9E6L4|GPDA_MACCJ Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Macrococcus caseolyticus (strain JCSC5402) GN=gpsA PE=3 SV=1 212 349 7.0E-21
sp|Q8NQV3|GPDA_CORGL Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=gpsA PE=3 SV=1 24 371 9.0E-21
sp|A4QDT3|GPDA_CORGB Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Corynebacterium glutamicum (strain R) GN=gpsA PE=3 SV=1 24 371 9.0E-21
sp|A8YUC9|GPDA_LACH4 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Lactobacillus helveticus (strain DPC 4571) GN=gpsA PE=3 SV=1 212 362 2.0E-20
sp|B3E9A1|GPDA_GEOLS Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=gpsA PE=3 SV=1 27 366 2.0E-20
sp|Q5WGU2|GPDA_BACSK Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Bacillus clausii (strain KSM-K16) GN=gpsA PE=3 SV=1 212 362 3.0E-20
sp|Q8NWM9|GPDA_STAAW Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Staphylococcus aureus (strain MW2) GN=gpsA PE=3 SV=1 17 319 4.0E-20
sp|A8Z453|GPDA_STAAT Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=gpsA PE=3 SV=1 17 319 4.0E-20
sp|Q6G989|GPDA_STAAS Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Staphylococcus aureus (strain MSSA476) GN=gpsA PE=3 SV=1 17 319 4.0E-20
sp|A6QH23|GPDA_STAAE Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Staphylococcus aureus (strain Newman) GN=gpsA PE=3 SV=1 17 319 4.0E-20
sp|Q5HFU9|GPDA_STAAC Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Staphylococcus aureus (strain COL) GN=gpsA PE=3 SV=1 17 319 4.0E-20
sp|Q2FYG1|GPDA_STAA8 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Staphylococcus aureus (strain NCTC 8325) GN=gpsA PE=3 SV=1 17 319 4.0E-20
sp|Q2FGW8|GPDA_STAA3 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Staphylococcus aureus (strain USA300) GN=gpsA PE=3 SV=1 17 319 4.0E-20
sp|Q30WH4|GPDA_DESAG Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Desulfovibrio alaskensis (strain G20) GN=gpsA PE=3 SV=1 32 373 4.0E-20
sp|Q6GGT7|GPDA_STAAR Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Staphylococcus aureus (strain MRSA252) GN=gpsA PE=3 SV=1 17 319 5.0E-20
sp|P61741|GPDA_LACJO Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=gpsA PE=3 SV=1 212 369 6.0E-20
sp|B1VYZ6|GPDA_STRGG Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=gpsA PE=3 SV=1 24 376 1.0E-19
sp|P64191|GPDA_STAAN Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Staphylococcus aureus (strain N315) GN=gpsA PE=1 SV=1 17 319 1.0E-19
sp|P64190|GPDA_STAAM Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=gpsA PE=3 SV=1 17 319 1.0E-19
sp|A5IT02|GPDA_STAA9 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Staphylococcus aureus (strain JH9) GN=gpsA PE=3 SV=1 17 319 1.0E-19
sp|A6U1U2|GPDA_STAA2 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Staphylococcus aureus (strain JH1) GN=gpsA PE=3 SV=1 17 319 1.0E-19
sp|A7X2I0|GPDA_STAA1 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=gpsA PE=3 SV=1 17 319 1.0E-19
sp|Q2YY82|GPDA_STAAB Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=gpsA PE=3 SV=1 17 319 1.0E-19
sp|Q49XS8|GPDA_STAS1 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=gpsA PE=3 SV=1 32 370 2.0E-19
sp|Q2N8R6|GPDA_ERYLH Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Erythrobacter litoralis (strain HTCC2594) GN=gpsA PE=3 SV=1 14 376 2.0E-19
sp|Q9ZBS0|GPDA_STRCO Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=gpsA PE=3 SV=1 24 376 2.0E-19
sp|Q4L6H9|GPDA_STAHJ Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Staphylococcus haemolyticus (strain JCSC1435) GN=gpsA PE=3 SV=1 32 362 5.0E-19
sp|Q12HV8|GPDA_SHEDO Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=gpsA PE=3 SV=1 16 376 6.0E-19
sp|B4SGX6|GPDA_PELPB Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=gpsA PE=3 SV=1 15 370 6.0E-19
sp|B0SKD9|GPDA_LEPBP Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=gpsA PE=3 SV=1 15 349 7.0E-19
sp|B0SAV3|GPDA_LEPBA Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=gpsA PE=3 SV=1 15 349 7.0E-19
sp|Q5NL81|GPDA_ZYMMO Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=gpsA PE=3 SV=1 24 376 7.0E-19
sp|A7Z635|GPDA_BACMF Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=gpsA PE=3 SV=1 207 369 8.0E-19
sp|Q04Y15|GPDA_LEPBL Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=gpsA PE=3 SV=1 15 349 9.0E-19
sp|Q3AAU8|GPDA_CARHZ Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=gpsA PE=3 SV=1 32 362 1.0E-18
sp|Q1MQ45|GPDA_LAWIP Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=gpsA PE=3 SV=1 207 364 1.0E-18
sp|A8GLB8|GPDA_SERP5 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Serratia proteamaculans (strain 568) GN=gpsA PE=3 SV=1 38 349 2.0E-18
sp|A1BJJ1|GPDA_CHLPD Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Chlorobium phaeobacteroides (strain DSM 266) GN=gpsA PE=3 SV=1 24 370 2.0E-18
sp|Q8CP63|GPDA_STAES Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Staphylococcus epidermidis (strain ATCC 12228) GN=gpsA PE=3 SV=2 212 372 2.0E-18
sp|Q8KRM1|GPDA_SERMA Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Serratia marcescens GN=gpsA PE=3 SV=1 38 349 2.0E-18
sp|C4L6M4|GPDA_EXISA Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=gpsA PE=3 SV=1 17 375 2.0E-18
sp|Q03GY3|GPDA_PEDPA Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=gpsA PE=3 SV=1 188 370 2.0E-18
sp|Q2SIH7|GPDA_HAHCH Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Hahella chejuensis (strain KCTC 2396) GN=gpsA PE=3 SV=1 17 319 3.0E-18
sp|Q1QBS6|GPDA_PSYCK Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Psychrobacter cryohalolentis (strain K5) GN=gpsA PE=3 SV=2 18 348 3.0E-18
sp|A1JHY5|GPDA_YERE8 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=gpsA PE=3 SV=1 38 366 3.0E-18
sp|Q82JS4|GPDA_STRAW Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=gpsA PE=3 SV=1 18 376 4.0E-18
sp|P61742|GPDA_LEPIC Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=gpsA PE=3 SV=1 15 349 5.0E-18
sp|C4XLT6|GPDA_DESMR Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Desulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1) GN=gpsA PE=3 SV=1 15 362 7.0E-18
sp|Q24VA4|GPDA_DESHY Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Desulfitobacterium hafniense (strain Y51) GN=gpsA PE=3 SV=1 8 340 7.0E-18
sp|Q0VPG2|GPDA_ALCBS Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=gpsA PE=3 SV=1 24 362 1.0E-17
sp|Q8EZB6|GPDA_LEPIN Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=gpsA PE=3 SV=1 15 349 1.0E-17
sp|Q04VF9|GPDA_LEPBJ Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=gpsA PE=3 SV=1 15 349 1.0E-17
sp|P46919|GPDA_BACSU Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Bacillus subtilis (strain 168) GN=gpsA PE=3 SV=2 212 369 1.0E-17
sp|Q38YA9|GPDA_LACSS Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=gpsA PE=3 SV=1 16 362 1.0E-17
sp|Q9KCD2|GPDA_BACHD Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=gpsA PE=3 SV=1 212 366 2.0E-17
sp|Q7MY54|GPDA_PHOLL Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=gpsA PE=3 SV=1 38 368 2.0E-17
sp|Q4FS72|GPDA_PSYA2 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=gpsA PE=3 SV=1 18 348 2.0E-17
sp|B0V862|GPDA_ACIBY Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Acinetobacter baumannii (strain AYE) GN=gpsA PE=3 SV=1 18 362 2.0E-17
sp|A3M6Y6|GPDA_ACIBT Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=gpsA PE=3 SV=2 18 362 2.0E-17
sp|B2HUU0|GPDA_ACIBC Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Acinetobacter baumannii (strain ACICU) GN=gpsA PE=3 SV=1 18 362 2.0E-17
sp|B7I2M0|GPDA_ACIB5 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Acinetobacter baumannii (strain AB0057) GN=gpsA PE=3 SV=1 18 362 2.0E-17
sp|B7GZW3|GPDA_ACIB3 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Acinetobacter baumannii (strain AB307-0294) GN=gpsA PE=3 SV=1 18 362 2.0E-17
sp|Q5HP71|GPDA_STAEQ Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=gpsA PE=3 SV=1 212 372 3.0E-17
sp|B0TLE9|GPDA_SHEHH Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Shewanella halifaxensis (strain HAW-EB4) GN=gpsA PE=3 SV=1 16 376 3.0E-17
sp|A4J3P3|GPDA_DESRM Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Desulfotomaculum reducens (strain MI-1) GN=gpsA PE=3 SV=1 24 366 3.0E-17
sp|B0VKB4|GPDA_ACIBS Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Acinetobacter baumannii (strain SDF) GN=gpsA PE=3 SV=1 18 362 4.0E-17
sp|Q3V7H1|GPDA_ACIAD Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=gpsA PE=3 SV=1 24 362 5.0E-17
sp|A5D1U4|GPDA_PELTS Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=gpsA PE=3 SV=1 32 319 5.0E-17
sp|B3EI28|GPDA_CHLL2 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=gpsA PE=3 SV=1 190 362 5.0E-17
sp|Q2S2I4|GPDA1_SALRD Glycerol-3-phosphate dehydrogenase [NAD(P)+] 1 OS=Salinibacter ruber (strain DSM 13855 / M31) GN=gpsA1 PE=3 SV=1 18 362 6.0E-17
sp|A8HAD7|GPDA_SHEPA Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=gpsA PE=3 SV=1 202 376 7.0E-17
sp|Q1WV00|GPDA_LACS1 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Lactobacillus salivarius (strain UCC118) GN=gpsA PE=3 SV=1 212 370 7.0E-17
sp|Q6DAT0|GPDA_PECAS Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=gpsA PE=3 SV=1 38 349 1.0E-16
sp|A9IM16|GPDA_BART1 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=gpsA PE=3 SV=1 22 370 1.0E-16
sp|Q8EQA9|GPDA_OCEIH Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=gpsA PE=3 SV=1 212 371 1.0E-16
sp|B3WCP6|GPDA_LACCB Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Lactobacillus casei (strain BL23) GN=gpsA PE=3 SV=1 207 362 1.0E-16
sp|Q07VX1|GPDA_SHEFN Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Shewanella frigidimarina (strain NCIMB 400) GN=gpsA PE=3 SV=1 16 376 2.0E-16
sp|Q03AM6|GPDA_LACC3 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Lactobacillus casei (strain ATCC 334) GN=gpsA PE=3 SV=1 207 362 2.0E-16
sp|Q88YK1|GPDA_LACPL Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=gpsA PE=3 SV=1 212 375 2.0E-16
sp|Q3AP01|GPDA_CHLCH Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Chlorobium chlorochromatii (strain CaD3) GN=gpsA PE=3 SV=1 15 362 2.0E-16
sp|Q8FPR0|GPDA_COREF Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=gpsA PE=3 SV=1 24 358 3.0E-16
sp|Q3A8M2|GPDA_PELCD Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=gpsA PE=3 SV=1 1 349 3.0E-16
sp|B1KQ10|GPDA_SHEWM Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=gpsA PE=3 SV=1 38 362 3.0E-16
sp|B8E3F7|GPDA_SHEB2 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Shewanella baltica (strain OS223) GN=gpsA PE=3 SV=1 38 376 3.0E-16
sp|Q67NS7|GPDA_SYMTH Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=gpsA PE=3 SV=1 218 376 3.0E-16
sp|Q02YK1|GPDA_LACLS Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=gpsA PE=3 SV=1 212 362 3.0E-16
sp|A6LSI7|GPDA_CLOB8 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=gpsA PE=3 SV=1 212 348 4.0E-16
sp|A2RK98|GPDA_LACLM Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=gpsA PE=3 SV=1 212 362 4.0E-16
sp|B8DBZ0|GPDA_LISMH Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=gpsA PE=3 SV=1 213 362 4.0E-16
sp|A9KUC1|GPDA_SHEB9 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Shewanella baltica (strain OS195) GN=gpsA PE=3 SV=1 38 376 4.0E-16
sp|Q8Y5W9|GPDA_LISMO Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=gpsA PE=3 SV=1 213 362 4.0E-16
sp|Q92A72|GPDA_LISIN Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=gpsA PE=3 SV=1 213 362 4.0E-16
sp|A6WHD0|GPDA_SHEB8 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Shewanella baltica (strain OS185) GN=gpsA PE=3 SV=1 38 376 4.0E-16
sp|Q71Y79|GPDA_LISMF Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Listeria monocytogenes serotype 4b (strain F2365) GN=gpsA PE=3 SV=1 213 362 4.0E-16
sp|C1KWN6|GPDA_LISMC Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=gpsA PE=3 SV=1 213 362 4.0E-16
sp|Q0ATQ3|GPDA_MARMM Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Maricaulis maris (strain MCS10) GN=gpsA PE=3 SV=1 215 370 6.0E-16
sp|B8CGT3|GPDA_SHEPW Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=gpsA PE=3 SV=1 16 376 6.0E-16
sp|Q03SN4|GPDA_LACBA Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=gpsA PE=3 SV=1 182 368 6.0E-16
sp|Q13DY0|GPDA_RHOPS Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Rhodopseudomonas palustris (strain BisB5) GN=gpsA PE=3 SV=1 215 369 7.0E-16
sp|Q6LVK9|GPDA_PHOPR Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Photobacterium profundum GN=gpsA PE=3 SV=1 38 349 7.0E-16
sp|A0AK48|GPDA_LISW6 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=gpsA PE=3 SV=1 184 362 7.0E-16
sp|Q895X7|GPDA_CLOTE Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Clostridium tetani (strain Massachusetts / E88) GN=gpsA PE=3 SV=1 212 344 7.0E-16
sp|B8CWZ1|GPDA_HALOH Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=gpsA PE=3 SV=1 207 367 7.0E-16
sp|B8J2B6|GPDA_DESDA Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=gpsA PE=3 SV=1 17 362 7.0E-16
sp|C6BYZ0|GPDA_DESAD Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=gpsA PE=3 SV=1 212 366 8.0E-16
sp|B2THR0|GPDA_CLOBB Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=gpsA PE=3 SV=1 212 323 8.0E-16
sp|Q2RIV6|GPDA_MOOTA Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Moorella thermoacetica (strain ATCC 39073) GN=gpsA PE=3 SV=1 212 370 9.0E-16
sp|A6TFK3|GPDA_KLEP7 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=gpsA PE=3 SV=1 197 349 1.0E-15
sp|B5XTJ2|GPDA_KLEP3 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Klebsiella pneumoniae (strain 342) GN=gpsA PE=3 SV=1 38 349 1.0E-15
sp|A4G993|GPDA_HERAR Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Herminiimonas arsenicoxydans GN=gpsA PE=3 SV=1 214 362 1.0E-15
sp|Q3B182|GPDA_CHLL7 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=gpsA PE=3 SV=1 195 370 1.0E-15
sp|A3DAM7|GPDA_SHEB5 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=gpsA PE=3 SV=1 38 376 1.0E-15
sp|Q39ZR6|GPDA_GEOMG Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=gpsA PE=3 SV=1 212 320 1.0E-15
sp|Q3K2X7|GPDA_STRA1 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=gpsA PE=3 SV=1 194 339 2.0E-15
sp|O67555|GPDA_AQUAE Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Aquifex aeolicus (strain VF5) GN=gpsA PE=3 SV=2 218 365 2.0E-15
sp|Q8E1E8|GPDA_STRA5 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=gpsA PE=3 SV=1 194 339 2.0E-15
sp|B2V3Z2|GPDA_CLOBA Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=gpsA PE=3 SV=1 212 339 2.0E-15
sp|Q8E6W6|GPDA_STRA3 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Streptococcus agalactiae serotype III (strain NEM316) GN=gpsA PE=3 SV=1 212 339 2.0E-15
sp|Q3YRF6|GPDA_EHRCJ Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Ehrlichia canis (strain Jake) GN=gpsA PE=3 SV=1 36 369 2.0E-15
sp|Q8R9J3|GPDA_CALS4 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=gpsA PE=3 SV=1 213 349 2.0E-15
sp|Q8RF18|GPDA_FUSNN Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=gpsA PE=3 SV=1 36 362 2.0E-15
sp|A1RQ92|GPDA_SHESW Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Shewanella sp. (strain W3-18-1) GN=gpsA PE=3 SV=1 38 375 3.0E-15
sp|A4Y1E6|GPDA_SHEPC Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=gpsA PE=3 SV=1 38 375 3.0E-15
sp|C6E7R1|GPDA_GEOSM Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Geobacter sp. (strain M21) GN=gpsA PE=3 SV=1 213 339 3.0E-15
sp|C6DIA2|GPDA_PECCP Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=gpsA PE=3 SV=1 38 349 3.0E-15
sp|A5IEA7|GPDA_LEGPC Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Legionella pneumophila (strain Corby) GN=gpsA PE=3 SV=1 212 364 3.0E-15
sp|Q5ZT56|GPDA_LEGPH Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=gpsA PE=3 SV=2 212 364 3.0E-15
sp|Q5X2Y0|GPDA_LEGPA Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Legionella pneumophila (strain Paris) GN=gpsA PE=3 SV=1 212 364 3.0E-15
sp|Q47IF9|GPDA_DECAR Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Dechloromonas aromatica (strain RCB) GN=gpsA PE=3 SV=1 14 365 4.0E-15
sp|B1JQV5|GPDA_YERPY Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=gpsA PE=3 SV=1 38 349 4.0E-15
sp|Q66GB8|GPDA_YERPS Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=gpsA PE=3 SV=1 38 349 4.0E-15
sp|A4TSB8|GPDA_YERPP Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Yersinia pestis (strain Pestoides F) GN=gpsA PE=3 SV=1 38 349 4.0E-15
sp|Q1CD21|GPDA_YERPN Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=gpsA PE=3 SV=1 38 349 4.0E-15
sp|A9R691|GPDA_YERPG Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Yersinia pestis bv. Antiqua (strain Angola) GN=gpsA PE=3 SV=1 38 349 4.0E-15
sp|Q8ZJM6|GPDA_YERPE Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Yersinia pestis GN=gpsA PE=3 SV=1 38 349 4.0E-15
sp|B2JYQ1|GPDA_YERPB Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=gpsA PE=3 SV=1 38 349 4.0E-15
sp|Q1C286|GPDA_YERPA Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=gpsA PE=3 SV=1 38 349 4.0E-15
sp|A7FCV2|GPDA_YERP3 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=gpsA PE=3 SV=1 38 349 4.0E-15
sp|B3Q866|GPDA_RHOPT Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Rhodopseudomonas palustris (strain TIE-1) GN=gpsA PE=3 SV=1 215 369 4.0E-15
sp|Q03IN5|GPDA_STRTD Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=gpsA PE=3 SV=1 194 339 4.0E-15
sp|B9DVX9|GPDA_STRU0 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=gpsA PE=3 SV=1 194 339 4.0E-15
sp|Q2RND0|GPDA_RHORT Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=gpsA PE=3 SV=1 24 368 4.0E-15
sp|B5E7Q3|GPDA_GEOBB Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=gpsA PE=3 SV=1 213 339 4.0E-15
sp|A1V9Y4|GPDA_DESVV Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=gpsA PE=3 SV=1 209 362 4.0E-15
sp|Q5M2J1|GPDA_STRT2 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=gpsA PE=3 SV=2 194 339 5.0E-15
sp|Q5LXY7|GPDA_STRT1 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Streptococcus thermophilus (strain CNRZ 1066) GN=gpsA PE=3 SV=2 194 339 5.0E-15
sp|Q5WUE0|GPDA_LEGPL Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Legionella pneumophila (strain Lens) GN=gpsA PE=3 SV=1 212 364 5.0E-15
sp|Q9CFX6|GPDA_LACLA Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=gpsA PE=3 SV=1 205 362 5.0E-15
sp|Q2Y9Z2|GPDA_NITMU Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=gpsA PE=3 SV=1 213 362 5.0E-15
sp|Q0AIA0|GPDA_NITEC Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Nitrosomonas eutropha (strain C91) GN=gpsA PE=3 SV=1 213 373 5.0E-15
sp|Q2S2H6|GPDA2_SALRD Glycerol-3-phosphate dehydrogenase [NAD(P)+] 2 OS=Salinibacter ruber (strain DSM 13855 / M31) GN=gpsA2 PE=3 SV=2 18 371 6.0E-15
sp|P61739|GPDA_DESVH Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=gpsA PE=3 SV=1 209 362 7.0E-15
sp|Q5P7M9|GPDA_AROAE Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Aromatoleum aromaticum (strain EbN1) GN=gpsA PE=3 SV=1 213 362 8.0E-15
sp|Q7MGY7|GPDA_VIBVY Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Vibrio vulnificus (strain YJ016) GN=gpsA PE=3 SV=1 22 362 1.0E-14
sp|Q8DCW4|GPDA_VIBVU Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Vibrio vulnificus (strain CMCP6) GN=gpsA PE=3 SV=1 22 362 1.0E-14
sp|Q0I0Q3|GPDA_SHESR Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Shewanella sp. (strain MR-7) GN=gpsA PE=3 SV=1 38 376 1.0E-14
sp|Q0HP88|GPDA_SHESM Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Shewanella sp. (strain MR-4) GN=gpsA PE=3 SV=1 38 376 1.0E-14
sp|A0KR80|GPDA_SHESA Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Shewanella sp. (strain ANA-3) GN=gpsA PE=3 SV=1 38 376 1.0E-14
sp|C5BC33|GPDA_EDWI9 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Edwardsiella ictaluri (strain 93-146) GN=gpsA PE=3 SV=1 38 370 1.0E-14
sp|Q6AFK3|GPDA_LEIXX Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=gpsA PE=3 SV=1 217 380 1.0E-14
sp|C0QYQ8|GPDA_BRAHW Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Brachyspira hyodysenteriae (strain ATCC 49526 / WA1) GN=gpsA PE=3 SV=1 216 370 1.0E-14
sp|Q8EKN9|GPDA_SHEON Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Shewanella oneidensis (strain MR-1) GN=gpsA PE=3 SV=1 38 375 1.0E-14
sp|Q8KG76|GPDA_CHLTE Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=gpsA PE=3 SV=1 213 366 1.0E-14
sp|P61740|GPDA_GEOSL Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=gpsA PE=3 SV=1 197 366 1.0E-14
sp|A4W537|GPDA_ENT38 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Enterobacter sp. (strain 638) GN=gpsA PE=3 SV=1 38 349 1.0E-14
sp|Q65QE0|GPDA_MANSM Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Mannheimia succiniciproducens (strain MBEL55E) GN=gpsA PE=3 SV=1 36 349 1.0E-14
sp|Q2J3D3|GPDA_RHOP2 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Rhodopseudomonas palustris (strain HaA2) GN=gpsA PE=3 SV=1 215 369 1.0E-14
sp|Q6G518|GPDA_BARHE Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=gpsA PE=3 SV=1 16 370 1.0E-14
sp|P58141|GPDA_CAUCR Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=gpsA PE=3 SV=1 24 369 1.0E-14
sp|Q93D83|GPDA_STRMU Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=gpsA PE=3 SV=1 194 376 2.0E-14
sp|A4VY17|GPDA_STRSY Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Streptococcus suis (strain 05ZYH33) GN=gpsA PE=3 SV=1 194 370 2.0E-14
sp|A4W4A9|GPDA_STRS2 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Streptococcus suis (strain 98HAH33) GN=gpsA PE=3 SV=1 194 370 2.0E-14
sp|B6J4L3|GPDA_COXB1 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Coxiella burnetii (strain CbuK_Q154) GN=gpsA PE=3 SV=1 213 362 2.0E-14
sp|C4LJE8|GPDA_CORK4 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Corynebacterium kroppenstedtii (strain DSM 44385 / CCUG 35717) GN=gpsA PE=3 SV=1 24 358 2.0E-14
sp|Q83BJ0|GPDA_COXBU Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=gpsA PE=1 SV=1 213 362 2.0E-14
sp|A9KF85|GPDA_COXBN Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Coxiella burnetii (strain Dugway 5J108-111) GN=gpsA PE=3 SV=1 213 362 2.0E-14
sp|B6IYY5|GPDA_COXB2 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Coxiella burnetii (strain CbuG_Q212) GN=gpsA PE=3 SV=1 213 362 2.0E-14
sp|B5XJM4|GPDA_STRPZ Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=gpsA PE=3 SV=1 194 339 2.0E-14
sp|P0DB23|GPDA_STRPQ Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=gpsA PE=3 SV=1 194 339 2.0E-14
sp|A2RCE5|GPDA_STRPG Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=gpsA PE=3 SV=1 194 339 2.0E-14
sp|Q1J8M2|GPDA_STRPF Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=gpsA PE=3 SV=1 194 339 2.0E-14
sp|Q1JNL6|GPDA_STRPC Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=gpsA PE=3 SV=1 194 339 2.0E-14
sp|Q1JDQ0|GPDA_STRPB Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=gpsA PE=3 SV=1 194 339 2.0E-14
sp|P68889|GPDA_STRP8 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=gpsA PE=3 SV=1 194 339 2.0E-14
sp|P0DB22|GPDA_STRP3 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=gpsA PE=3 SV=1 194 339 2.0E-14
sp|P68887|GPDA_STRP1 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Streptococcus pyogenes serotype M1 GN=gpsA PE=3 SV=1 194 339 2.0E-14
sp|Q1JIR5|GPDA_STRPD Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=gpsA PE=3 SV=1 194 339 3.0E-14
sp|Q5XE03|GPDA_STRP6 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=gpsA PE=1 SV=1 194 339 3.0E-14
sp|A1TTW1|GPDA_ACIAC Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Acidovorax citrulli (strain AAC00-1) GN=gpsA PE=3 SV=1 24 375 3.0E-14
sp|Q5SHJ0|GPDA_THET8 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=gpsA PE=3 SV=1 212 323 3.0E-14
sp|P61747|GPDA_THET2 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=gpsA PE=3 SV=1 212 323 3.0E-14
sp|B0K3E2|GPDA_THEPX Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Thermoanaerobacter sp. (strain X514) GN=gpsA PE=3 SV=1 213 362 3.0E-14
sp|B0K8N5|GPDA_THEP3 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=gpsA PE=3 SV=1 213 362 3.0E-14
sp|A9N956|GPDA_COXBR Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=gpsA PE=3 SV=1 213 362 3.0E-14
sp|A8G1U6|GPDA_SHESH Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Shewanella sediminis (strain HAW-EB3) GN=gpsA PE=3 SV=1 212 349 4.0E-14
sp|A6T310|GPDA_JANMA Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Janthinobacterium sp. (strain Marseille) GN=gpsA PE=3 SV=1 214 381 4.0E-14
sp|C1CTZ5|GPDA_STRZT Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=gpsA PE=3 SV=1 194 370 4.0E-14
sp|B2IN10|GPDA_STRPS Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Streptococcus pneumoniae (strain CGSP14) GN=gpsA PE=3 SV=1 194 370 4.0E-14
sp|Q97NF1|GPDA_STRPN Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=gpsA PE=1 SV=1 194 370 4.0E-14
sp|C1CAR8|GPDA_STRP7 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Streptococcus pneumoniae (strain 70585) GN=gpsA PE=3 SV=1 194 370 4.0E-14
sp|P61746|GPDA_RHOPA Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=gpsA PE=3 SV=1 215 369 4.0E-14
sp|Q0SS67|GPDA_CLOPS Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Clostridium perfringens (strain SM101 / Type A) GN=gpsA PE=3 SV=1 212 323 5.0E-14
sp|B5E399|GPDA_STRP4 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=gpsA PE=3 SV=1 194 370 5.0E-14
sp|A1S1L9|GPDA_SHEAM Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=gpsA PE=3 SV=1 212 376 5.0E-14
sp|B1I9F8|GPDA_STRPI Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=gpsA PE=3 SV=1 194 370 5.0E-14
sp|C1CH20|GPDA_STRZJ Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Streptococcus pneumoniae (strain JJA) GN=gpsA PE=3 SV=1 194 370 5.0E-14
sp|Q8DN59|GPDA_STRR6 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=gpsA PE=3 SV=1 194 370 5.0E-14
sp|B8ZPL4|GPDA_STRPJ Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=gpsA PE=3 SV=1 194 370 5.0E-14
sp|Q04I82|GPDA_STRP2 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=gpsA PE=3 SV=1 194 370 5.0E-14
sp|Q7M7Y3|GPDA_WOLSU Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=gpsA PE=3 SV=1 213 376 5.0E-14
sp|A5UAS0|GPDA_HAEIE Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Haemophilus influenzae (strain PittEE) GN=gpsA PE=3 SV=1 218 371 6.0E-14
sp|Q4QMJ1|GPDA_HAEI8 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Haemophilus influenzae (strain 86-028NP) GN=gpsA PE=3 SV=1 218 371 6.0E-14
sp|P43798|GPDA_HAEIN Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=gpsA PE=3 SV=1 218 371 6.0E-14
sp|Q1MAQ9|GPDA_RHIL3 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=gpsA PE=3 SV=1 35 370 6.0E-14
sp|Q48VF4|GPDA_STRPM Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=gpsA PE=3 SV=1 212 339 6.0E-14
sp|A3CQT0|GPDA_STRSV Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Streptococcus sanguinis (strain SK36) GN=gpsA PE=3 SV=1 32 339 6.0E-14
sp|C1CN37|GPDA_STRZP Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Streptococcus pneumoniae (strain P1031) GN=gpsA PE=3 SV=1 194 370 6.0E-14
sp|C0M6I2|GPDA_STRE4 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Streptococcus equi subsp. equi (strain 4047) GN=gpsA PE=3 SV=1 212 339 7.0E-14
sp|C0MFI2|GPDA_STRS7 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=gpsA PE=3 SV=1 212 339 7.0E-14
sp|B3PQA3|GPDA_RHIE6 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Rhizobium etli (strain CIAT 652) GN=gpsA PE=3 SV=1 35 370 7.0E-14
sp|A8AUM5|GPDA_STRGC Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=gpsA PE=3 SV=1 194 339 7.0E-14
sp|Q82SU6|GPDA_NITEU Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=gpsA PE=3 SV=1 224 379 7.0E-14
sp|B4U0Q8|GPDA_STREM Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=gpsA PE=3 SV=1 212 339 7.0E-14
sp|Q6G0U8|GPDA_BARQU Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Bartonella quintana (strain Toulouse) GN=gpsA PE=3 SV=1 207 368 7.0E-14
sp|Q9CL17|GPDA_PASMU Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Pasteurella multocida (strain Pm70) GN=gpsA PE=3 SV=1 37 371 7.0E-14
sp|B3GYJ1|GPDA_ACTP7 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=gpsA PE=3 SV=1 22 371 8.0E-14
sp|A3N2F8|GPDA_ACTP2 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=gpsA PE=3 SV=1 22 371 8.0E-14
sp|P0A1P2|GPDA_SALTY Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=gpsA PE=3 SV=1 210 349 8.0E-14
sp|P0A1P3|GPDA_SALTI Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Salmonella typhi GN=gpsA PE=3 SV=1 210 349 8.0E-14
sp|B4TZV1|GPDA_SALSV Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Salmonella schwarzengrund (strain CVM19633) GN=gpsA PE=3 SV=1 210 349 8.0E-14
sp|B5BHY3|GPDA_SALPK Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Salmonella paratyphi A (strain AKU_12601) GN=gpsA PE=3 SV=1 210 349 8.0E-14
sp|C0Q1U2|GPDA_SALPC Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Salmonella paratyphi C (strain RKS4594) GN=gpsA PE=3 SV=1 210 349 8.0E-14
sp|A9MVK2|GPDA_SALPB Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=gpsA PE=3 SV=1 210 349 8.0E-14
sp|Q5PBZ6|GPDA_SALPA Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=gpsA PE=3 SV=1 210 349 8.0E-14
sp|B4SXB1|GPDA_SALNS Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Salmonella newport (strain SL254) GN=gpsA PE=3 SV=1 210 349 8.0E-14
sp|B4T993|GPDA_SALHS Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Salmonella heidelberg (strain SL476) GN=gpsA PE=3 SV=1 210 349 8.0E-14
sp|B5RGH8|GPDA_SALG2 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=gpsA PE=3 SV=1 210 349 8.0E-14
sp|B5R5D3|GPDA_SALEP Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Salmonella enteritidis PT4 (strain P125109) GN=gpsA PE=3 SV=1 210 349 8.0E-14
sp|B5FLH8|GPDA_SALDC Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Salmonella dublin (strain CT_02021853) GN=gpsA PE=3 SV=1 210 349 8.0E-14
sp|Q57ID3|GPDA_SALCH Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Salmonella choleraesuis (strain SC-B67) GN=gpsA PE=3 SV=1 210 349 8.0E-14
sp|A9MKR6|GPDA_SALAR Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=gpsA PE=3 SV=1 210 349 8.0E-14
sp|B5EXB5|GPDA_SALA4 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Salmonella agona (strain SL483) GN=gpsA PE=3 SV=1 210 349 8.0E-14
sp|Q7NF59|GPDA_GLOVI Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Gloeobacter violaceus (strain PCC 7421) GN=gpsA PE=3 SV=1 218 366 8.0E-14
sp|C5CWV5|GPDA_VARPS Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Variovorax paradoxus (strain S110) GN=gpsA PE=3 SV=1 36 365 8.0E-14
sp|Q8XJK2|GPDA_CLOPE Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Clostridium perfringens (strain 13 / Type A) GN=gpsA PE=3 SV=1 212 339 9.0E-14
sp|Q0TPK0|GPDA_CLOP1 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=gpsA PE=3 SV=1 212 339 9.0E-14
sp|Q03YL0|GPDA_LEUMM Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=gpsA PE=3 SV=1 32 371 9.0E-14
sp|A7MX60|GPDA_VIBCB Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=gpsA PE=3 SV=1 22 362 9.0E-14
sp|A3QJM1|GPDA_SHELP Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=gpsA PE=3 SV=1 212 349 1.0E-13
sp|B1XS88|GPDA_POLNS Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=gpsA PE=3 SV=1 199 375 1.0E-13
sp|B2S4P6|GPDA_TREPS Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Treponema pallidum subsp. pallidum (strain SS14) GN=gpsA PE=3 SV=1 24 369 1.0E-13
sp|O83973|GPDA_TREPA Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Treponema pallidum (strain Nichols) GN=gpsA PE=3 SV=1 24 369 1.0E-13
sp|C4ZD61|GPDA_EUBR3 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=gpsA PE=3 SV=1 182 323 1.0E-13
sp|Q1IPR2|GPDA_KORVE Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Koribacter versatilis (strain Ellin345) GN=gpsA PE=3 SV=1 26 376 1.0E-13
sp|A8IJ80|GPDA_AZOC5 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=gpsA PE=3 SV=1 218 369 1.0E-13
sp|B0BRA3|GPDA_ACTPJ Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=gpsA PE=3 SV=1 22 371 2.0E-13
sp|Q5E2A3|GPDA_VIBF1 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=gpsA PE=3 SV=1 38 362 2.0E-13
sp|A4YK34|GPDA_BRASO Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Bradyrhizobium sp. (strain ORS278) GN=gpsA PE=3 SV=1 215 369 2.0E-13
sp|Q1GZ87|GPDA_METFK Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=gpsA PE=3 SV=1 212 362 2.0E-13
sp|B5ZTC4|GPDA_RHILW Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=gpsA PE=3 SV=1 9 370 2.0E-13
sp|Q8PQU9|GPDA_XANAC Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Xanthomonas axonopodis pv. citri (strain 306) GN=gpsA PE=3 SV=1 213 365 2.0E-13
sp|Q21DB2|GPDA_RHOPB Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Rhodopseudomonas palustris (strain BisB18) GN=gpsA PE=3 SV=1 41 369 2.0E-13
sp|C3LRW2|GPDA_VIBCM Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Vibrio cholerae serotype O1 (strain M66-2) GN=gpsA PE=3 SV=1 38 362 2.0E-13
sp|Q9KNT0|GPDA_VIBCH Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=gpsA PE=3 SV=1 38 362 2.0E-13
sp|A5F502|GPDA_VIBC3 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=gpsA PE=3 SV=1 38 362 2.0E-13
sp|Q47VY6|GPDA_COLP3 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=gpsA PE=3 SV=1 207 365 2.0E-13
sp|Q3SG93|GPDA_THIDA Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Thiobacillus denitrificans (strain ATCC 25259) GN=gpsA PE=3 SV=1 215 362 2.0E-13
sp|Q2K3D8|GPDA_RHIEC Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=gpsA PE=3 SV=1 9 370 3.0E-13
sp|A8ARJ5|GPDA_CITK8 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=gpsA PE=3 SV=1 211 349 3.0E-13
sp|B3PHG2|GPDA_CELJU Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Cellvibrio japonicus (strain Ueda107) GN=gpsA PE=3 SV=1 37 372 3.0E-13
sp|Q97ID6|GPDA_CLOAB Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=gpsA PE=3 SV=1 4 362 3.0E-13
sp|Q0SE35|GPDA1_RHOJR Glycerol-3-phosphate dehydrogenase [NAD(P)+] 1 OS=Rhodococcus jostii (strain RHA1) GN=gpsA1 PE=3 SV=1 212 366 4.0E-13
sp|B2G5Z4|GPDA_LACRJ Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Lactobacillus reuteri (strain JCM 1112) GN=gpsA PE=3 SV=1 17 340 4.0E-13
sp|A5VIG6|GPDA_LACRD Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Lactobacillus reuteri (strain DSM 20016) GN=gpsA PE=3 SV=1 17 340 4.0E-13
sp|Q31V13|GPDA_SHIBS Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Shigella boydii serotype 4 (strain Sb227) GN=gpsA PE=3 SV=1 210 349 4.0E-13
sp|B2U5C7|GPDA_SHIB3 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=gpsA PE=3 SV=1 210 349 4.0E-13
sp|C5BL79|GPDA_TERTT Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=gpsA PE=3 SV=1 36 371 4.0E-13
sp|Q9RR76|GPDA_DEIRA Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=gpsA PE=3 SV=1 32 365 4.0E-13
sp|B8F6W7|GPDA_HAEPS Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=gpsA PE=3 SV=1 218 373 5.0E-13
sp|Q5QZB8|GPDA_IDILO Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=gpsA PE=3 SV=1 211 367 5.0E-13
sp|Q2GHC3|GPDA_EHRCR Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=gpsA PE=3 SV=1 36 371 6.0E-13
sp|Q3IIE0|GPDA_PSEHT Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=gpsA PE=3 SV=1 36 370 6.0E-13
sp|P61738|GPDA_CORDI Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=gpsA PE=3 SV=1 216 371 6.0E-13
sp|B2VL53|GPDA_ERWT9 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=gpsA PE=3 SV=1 41 370 6.0E-13
sp|Q604K1|GPDA_METCA Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=gpsA PE=3 SV=1 213 362 6.0E-13
sp|A1UTZ3|GPDA_BARBK Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=gpsA PE=3 SV=1 213 375 7.0E-13
sp|Q6F1R6|GPDA_MESFL Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=gpsA PE=3 SV=1 212 339 7.0E-13
sp|Q3BZ75|GPDA_XANC5 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=gpsA PE=3 SV=1 213 365 8.0E-13
sp|Q7VNA0|GPDA_HAEDU Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=gpsA PE=3 SV=1 218 371 9.0E-13
sp|Q1DCL2|GPDA_MYXXD Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Myxococcus xanthus (strain DK 1622) GN=gpsA PE=3 SV=1 24 300 9.0E-13
sp|A5E8T9|GPDA_BRASB Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=gpsA PE=3 SV=1 216 369 1.0E-12
sp|B7NER5|GPDA_ECOLU Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=gpsA PE=3 SV=1 210 349 1.0E-12
sp|Q2NQW6|GPDA_SODGM Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Sodalis glossinidius (strain morsitans) GN=gpsA PE=3 SV=1 210 366 1.0E-12
sp|C3PFZ8|GPDA_CORA7 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1) GN=gpsA PE=3 SV=1 216 371 1.0E-12
sp|Q0SYD4|GPDA_SHIF8 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Shigella flexneri serotype 5b (strain 8401) GN=gpsA PE=3 SV=1 210 349 1.0E-12
sp|Q3YVX3|GPDA_SHISS Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Shigella sonnei (strain Ss046) GN=gpsA PE=3 SV=1 210 349 1.0E-12
sp|P0A6T0|GPDA_SHIFL Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Shigella flexneri GN=gpsA PE=3 SV=1 210 349 1.0E-12
sp|Q329P6|GPDA_SHIDS Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=gpsA PE=3 SV=1 210 349 1.0E-12
sp|Q1R4Y7|GPDA_ECOUT Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Escherichia coli (strain UTI89 / UPEC) GN=gpsA PE=3 SV=1 210 349 1.0E-12
sp|B1LK47|GPDA_ECOSM Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=gpsA PE=3 SV=1 210 349 1.0E-12
sp|B6I3I7|GPDA_ECOSE Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Escherichia coli (strain SE11) GN=gpsA PE=3 SV=1 210 349 1.0E-12
sp|P0A6S7|GPDA_ECOLI Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Escherichia coli (strain K12) GN=gpsA PE=3 SV=1 210 349 1.0E-12
sp|P0A6S8|GPDA_ECOL6 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=gpsA PE=3 SV=1 210 349 1.0E-12
sp|Q0TBJ8|GPDA_ECOL5 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=gpsA PE=3 SV=1 210 349 1.0E-12
sp|A1AHE5|GPDA_ECOK1 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Escherichia coli O1:K1 / APEC GN=gpsA PE=3 SV=1 210 349 1.0E-12
sp|A8A673|GPDA_ECOHS Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Escherichia coli O9:H4 (strain HS) GN=gpsA PE=3 SV=1 210 349 1.0E-12
sp|B1X942|GPDA_ECODH Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Escherichia coli (strain K12 / DH10B) GN=gpsA PE=3 SV=1 210 349 1.0E-12
sp|C4ZXK0|GPDA_ECOBW Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=gpsA PE=3 SV=1 210 349 1.0E-12
sp|B7M495|GPDA_ECO8A Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Escherichia coli O8 (strain IAI1) GN=gpsA PE=3 SV=1 210 349 1.0E-12
sp|B7N254|GPDA_ECO81 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Escherichia coli O81 (strain ED1a) GN=gpsA PE=3 SV=1 210 349 1.0E-12
sp|B7NPB7|GPDA_ECO7I Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=gpsA PE=3 SV=1 210 349 1.0E-12
sp|B5YWB0|GPDA_ECO5E Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=gpsA PE=3 SV=1 210 349 1.0E-12
sp|P0A6S9|GPDA_ECO57 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Escherichia coli O157:H7 GN=gpsA PE=3 SV=1 210 349 1.0E-12
sp|B7L734|GPDA_ECO55 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Escherichia coli (strain 55989 / EAEC) GN=gpsA PE=3 SV=1 210 349 1.0E-12
sp|B7MFH2|GPDA_ECO45 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=gpsA PE=3 SV=1 210 349 1.0E-12
sp|B7ULG4|GPDA_ECO27 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=gpsA PE=3 SV=1 210 349 1.0E-12
sp|A7ZTG2|GPDA_ECO24 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=gpsA PE=3 SV=1 210 349 1.0E-12
sp|Q3JF19|GPDA_NITOC Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=gpsA PE=3 SV=1 208 319 1.0E-12
sp|B7LTL5|GPDA_ESCF3 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=gpsA PE=3 SV=1 210 349 1.0E-12
sp|Q21YV6|GPDA_RHOFT Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=gpsA PE=3 SV=1 24 375 1.0E-12
sp|Q4QHG4|GPDA_LEIMA Glycerol-3-phosphate dehydrogenase [NAD(+)], glycosomal OS=Leishmania major GN=GPD PE=3 SV=1 31 366 1.0E-12
sp|Q7VRK7|GPDA_BLOFL Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Blochmannia floridanus GN=gpsA PE=3 SV=1 204 370 1.0E-12
sp|B0T285|GPDA_CAUSK Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Caulobacter sp. (strain K31) GN=gpsA PE=3 SV=1 24 370 1.0E-12
sp|A4T092|GPDA_POLSQ Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=gpsA PE=3 SV=1 207 365 1.0E-12
sp|Q87KZ2|GPDA_VIBPA Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=gpsA PE=3 SV=1 22 362 1.0E-12
sp|B8GR94|GPDA_THISH Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=gpsA PE=3 SV=1 213 362 2.0E-12
sp|A7MQ75|GPDA_CROS8 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=gpsA PE=3 SV=1 210 349 2.0E-12
sp|B1IZI2|GPDA_ECOLC Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=gpsA PE=3 SV=1 210 349 2.0E-12
sp|Q1GP43|GPDA1_SPHAL Glycerol-3-phosphate dehydrogenase [NAD(P)+] 1 OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=gpsA1 PE=3 SV=1 24 370 2.0E-12
sp|B4UB18|GPDA_ANASK Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Anaeromyxobacter sp. (strain K) GN=gpsA PE=3 SV=1 213 362 2.0E-12
sp|Q5GV21|GPDA_XANOR Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=gpsA PE=3 SV=2 213 365 2.0E-12
sp|Q2NYA5|GPDA_XANOM Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=gpsA PE=3 SV=1 213 365 2.0E-12
sp|Q07VK7|GPDA_RHOP5 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Rhodopseudomonas palustris (strain BisA53) GN=gpsA PE=3 SV=1 215 369 2.0E-12
sp|B8JAX1|GPDA_ANAD2 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=gpsA PE=3 SV=1 213 362 3.0E-12
sp|A1WWC7|GPDA_HALHL Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=gpsA PE=3 SV=1 213 370 3.0E-12
sp|Q8PDY0|GPDA_XANCP Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=gpsA PE=3 SV=1 213 365 3.0E-12
sp|B0RLW9|GPDA_XANCB Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Xanthomonas campestris pv. campestris (strain B100) GN=gpsA PE=3 SV=1 213 365 3.0E-12
sp|Q4V072|GPDA_XANC8 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Xanthomonas campestris pv. campestris (strain 8004) GN=gpsA PE=3 SV=1 213 365 3.0E-12
sp|B2ID14|GPDA_BEII9 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=gpsA PE=3 SV=1 216 370 3.0E-12
sp|Q2IMY8|GPDA_ANADE Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=gpsA PE=3 SV=1 213 362 3.0E-12
sp|Q12F46|GPDA_POLSJ Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=gpsA PE=3 SV=1 24 365 4.0E-12
sp|Q30QX3|GPDA_SULDN Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=gpsA PE=3 SV=1 205 348 4.0E-12
sp|B2V656|GPDA_SULSY Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=gpsA PE=3 SV=1 218 349 4.0E-12
sp|B4SSF9|GPDA_STRM5 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Stenotrophomonas maltophilia (strain R551-3) GN=gpsA PE=3 SV=1 213 366 4.0E-12
sp|B2FHD8|GPDA_STRMK Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Stenotrophomonas maltophilia (strain K279a) GN=gpsA PE=3 SV=1 213 366 4.0E-12
sp|Q87CK3|GPDA_XYLFT Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=gpsA PE=3 SV=1 205 363 5.0E-12
sp|Q7NYZ3|GPDA_CHRVO Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=gpsA PE=3 SV=1 213 362 5.0E-12
sp|B2I5B4|GPDA_XYLF2 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Xylella fastidiosa (strain M23) GN=gpsA PE=3 SV=1 205 363 5.0E-12
sp|Q8DH49|GPDA_THEEB Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Thermosynechococcus elongatus (strain BP-1) GN=gpsA PE=3 SV=1 216 365 6.0E-12
sp|Q5L4X5|GPDA_CHLAB Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=gpsA PE=3 SV=1 213 362 7.0E-12
sp|Q256B4|GPDA_CHLFF Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Chlamydophila felis (strain Fe/C-56) GN=gpsA PE=3 SV=1 213 362 7.0E-12
sp|B0U2T8|GPDA_XYLFM Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Xylella fastidiosa (strain M12) GN=gpsA PE=3 SV=1 205 363 8.0E-12
sp|Q821M8|GPDA_CHLCV Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Chlamydophila caviae (strain GPIC) GN=gpsA PE=3 SV=1 213 362 9.0E-12
sp|Q2G4K3|GPDA_NOVAD Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=gpsA PE=3 SV=1 205 371 1.0E-11
sp|Q7VI15|GPDA_HELHP Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=gpsA PE=3 SV=1 216 376 1.0E-11
sp|Q8YWC2|GPDA_NOSS1 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=gpsA PE=3 SV=1 210 365 1.0E-11
sp|B5YEC5|GPDA_DICT6 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=gpsA PE=3 SV=1 15 336 1.0E-11
sp|Q2J6X6|GPDA_FRASC Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Frankia sp. (strain CcI3) GN=gpsA PE=3 SV=1 216 324 1.0E-11
sp|Q1LTT0|GPDA_BAUCH Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=gpsA PE=3 SV=1 210 370 1.0E-11
sp|A1WBI9|GPDA_ACISJ Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Acidovorax sp. (strain JS42) GN=gpsA PE=3 SV=1 38 375 1.0E-11
sp|A4ST20|GPDA_AERS4 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Aeromonas salmonicida (strain A449) GN=gpsA PE=3 SV=1 197 349 1.0E-11
sp|A0KF08|GPDA_AERHH Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=gpsA PE=3 SV=1 209 349 2.0E-11
sp|B2GAJ3|GPDA_LACF3 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=gpsA PE=3 SV=1 212 362 2.0E-11
sp|Q5YRY6|GPDA_NOCFA Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Nocardia farcinica (strain IFM 10152) GN=gpsA PE=3 SV=1 213 361 3.0E-11
sp|A1SZH9|GPDA_PSYIN Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Psychromonas ingrahamii (strain 37) GN=gpsA PE=3 SV=1 212 349 3.0E-11
sp|Q9PCH7|GPDA_XYLFA Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Xylella fastidiosa (strain 9a5c) GN=gpsA PE=3 SV=1 213 363 3.0E-11
sp|B0C2F0|GPDA_ACAM1 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Acaryochloris marina (strain MBIC 11017) GN=gpsA PE=3 SV=1 207 365 3.0E-11
sp|B1Y6P0|GPDA_LEPCP Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=gpsA PE=3 SV=1 205 364 3.0E-11
sp|Q3MDZ9|GPDA_ANAVT Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=gpsA PE=3 SV=1 210 312 4.0E-11
sp|Q476J3|GPDA_CUPPJ Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=gpsA PE=3 SV=1 203 320 4.0E-11
sp|Q5HTR8|GPDA_CAMJR Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Campylobacter jejuni (strain RM1221) GN=gpsA PE=3 SV=1 213 365 4.0E-11
sp|Q9PN99|GPDA_CAMJE Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=gpsA PE=3 SV=2 213 365 4.0E-11
sp|Q0A5H5|GPDA_ALKEH Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=gpsA PE=3 SV=1 213 365 4.0E-11
sp|A1W0I0|GPDA_CAMJJ Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=gpsA PE=3 SV=1 213 365 4.0E-11
sp|Q1IWP7|GPDA_DEIGD Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Deinococcus geothermalis (strain DSM 11300) GN=gpsA PE=3 SV=1 216 365 4.0E-11
sp|A9BHX5|GPDA_PETMO Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=gpsA PE=3 SV=1 212 323 5.0E-11
sp|A8FMQ2|GPDA_CAMJ8 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=gpsA PE=3 SV=1 213 365 5.0E-11
sp|A7HST0|GPDA_PARL1 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=gpsA PE=3 SV=1 215 364 7.0E-11
sp|P61743|GPDA1_MYCPA Glycerol-3-phosphate dehydrogenase 1 [NAD(P)+] OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=gpsA1 PE=3 SV=1 209 375 7.0E-11
sp|A9AEK1|GPDA_BURM1 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=gpsA PE=3 SV=1 213 362 7.0E-11
sp|Q6MF42|GPDA_PARUW Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Protochlamydia amoebophila (strain UWE25) GN=gpsA PE=3 SV=1 213 364 8.0E-11
sp|Q28JW6|GPDA_JANSC Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Jannaschia sp. (strain CCS1) GN=gpsA PE=3 SV=1 213 305 8.0E-11
sp|Q11DE9|GPDA_CHESB Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Chelativorans sp. (strain BNC1) GN=gpsA PE=3 SV=1 216 368 1.0E-10
sp|B5EKH1|GPDA_ACIF5 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=gpsA PE=3 SV=1 213 362 1.0E-10
sp|B7J4Y4|GPDA_ACIF2 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=gpsA PE=3 SV=1 213 362 1.0E-10
sp|C4LA09|GPDA_TOLAT Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=gpsA PE=3 SV=1 225 370 1.0E-10
sp|B9MEY8|GPDA_ACIET Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Acidovorax ebreus (strain TPSY) GN=gpsA PE=3 SV=1 213 375 1.0E-10
sp|Q8UC48|GPDA_AGRFC Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=gpsA PE=3 SV=1 218 368 1.0E-10
sp|Q7W1R0|GPDA_BORPA Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=gpsA PE=3 SV=1 213 328 2.0E-10
sp|Q7WQN6|GPDA_BORBR Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=gpsA PE=3 SV=1 213 305 2.0E-10
sp|B7UVA7|GPDA_PSEA8 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Pseudomonas aeruginosa (strain LESB58) GN=gpsA PE=3 SV=1 32 319 2.0E-10
sp|Q3J6D1|GPDA_RHOS4 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=gpsA PE=3 SV=1 207 365 2.0E-10
sp|Q7VS47|GPDA_BORPE Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=gpsA PE=3 SV=1 213 305 2.0E-10
sp|Q1QUM1|GPDA_CHRSD Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=gpsA PE=3 SV=1 24 345 2.0E-10
sp|Q31E81|GPDA_THICR Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Thiomicrospira crunogena (strain XCL-2) GN=gpsA PE=3 SV=1 213 365 2.0E-10
sp|A5FPU2|GPDA_DEHMB Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=gpsA PE=3 SV=1 212 375 2.0E-10
sp|A6V7H8|GPDA_PSEA7 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Pseudomonas aeruginosa (strain PA7) GN=gpsA PE=3 SV=1 32 319 2.0E-10
sp|B9KD88|GPDA_CAMLR Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=gpsA PE=3 SV=1 213 380 2.0E-10
sp|A7H2I1|GPDA_CAMJD Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=gpsA PE=3 SV=1 213 365 2.0E-10
sp|Q0S2F8|GPDA2_RHOJR Glycerol-3-phosphate dehydrogenase [NAD(P)+] 2 OS=Rhodococcus jostii (strain RHA1) GN=gpsA2 PE=3 SV=1 213 370 2.0E-10
sp|Q2JPE4|GPDA_SYNJB Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=gpsA PE=3 SV=1 218 365 2.0E-10
sp|Q3ZYV3|GPDA_DEHMC Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Dehalococcoides mccartyi (strain CBDB1) GN=gpsA PE=3 SV=1 212 375 2.0E-10
sp|Q9I3A8|GPDA_PSEAE Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=gpsA PE=3 SV=1 32 319 3.0E-10
sp|Q02K99|GPDA_PSEAB Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=gpsA PE=3 SV=1 32 319 3.0E-10
sp|Q9Z751|GPDA_CHLPN Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Chlamydia pneumoniae GN=gpsA PE=3 SV=1 31 362 3.0E-10
sp|B2AGQ1|GPDA_CUPTR Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=gpsA PE=3 SV=1 213 375 3.0E-10
sp|A9NGK6|GPDA_ACHLI Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Acholeplasma laidlawii (strain PG-8A) GN=gpsA PE=3 SV=1 210 320 3.0E-10
sp|A1VKS0|GPDA_POLNA Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Polaromonas naphthalenivorans (strain CJ2) GN=gpsA PE=3 SV=1 38 375 3.0E-10
sp|A4XV57|GPDA_PSEMY Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Pseudomonas mendocina (strain ymp) GN=gpsA PE=3 SV=1 205 362 3.0E-10
sp|A2SDP0|GPDA_METPP Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Methylibium petroleiphilum (strain PM1) GN=gpsA PE=3 SV=1 213 365 3.0E-10
sp|Q2L0B2|GPDA_BORA1 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Bordetella avium (strain 197N) GN=gpsA PE=3 SV=1 213 320 4.0E-10
sp|Q8D216|GPDA_WIGBR Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Wigglesworthia glossinidia brevipalpis GN=gpsA PE=3 SV=1 213 299 4.0E-10
sp|A8L577|GPDA_FRASN Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Frankia sp. (strain EAN1pec) GN=gpsA PE=3 SV=1 216 320 4.0E-10
sp|Q9PLL2|GPDA_CHLMU Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Chlamydia muridarum (strain MoPn / Nigg) GN=gpsA PE=3 SV=1 197 362 4.0E-10
sp|C1F6U2|GPDA_ACIC5 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=gpsA PE=3 SV=1 225 365 4.0E-10
sp|C3K747|GPDA_PSEFS Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Pseudomonas fluorescens (strain SBW25) GN=gpsA PE=3 SV=1 205 375 5.0E-10
sp|A9BUZ7|GPDA_DELAS Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=gpsA PE=3 SV=1 213 370 5.0E-10
sp|C3MAF3|GPDA_RHISN Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Rhizobium sp. (strain NGR234) GN=gpsA PE=3 SV=1 216 368 5.0E-10
sp|P9WN75|GPDA2_MYCTU Probable glycerol-3-phosphate dehydrogenase 2 [NAD(P)+] OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=gpsA2 PE=1 SV=1 203 373 5.0E-10
sp|P9WN74|GPDA2_MYCTO Probable glycerol-3-phosphate dehydrogenase 2 [NAD(P)+] OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=gpsA2 PE=3 SV=1 203 373 5.0E-10
sp|P64189|GPDA2_MYCBO Probable glycerol-3-phosphate dehydrogenase 2 [NAD(P)+] OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=gpsA2 PE=3 SV=1 203 373 5.0E-10
sp|Q0C3I7|GPDA_HYPNA Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Hyphomonas neptunium (strain ATCC 15444) GN=gpsA PE=3 SV=1 27 370 5.0E-10
sp|Q17X25|GPDA_HELAH Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Helicobacter acinonychis (strain Sheeba) GN=gpsA PE=3 SV=1 213 375 7.0E-10
sp|Q8Y2H9|GPDA_RALSO Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Ralstonia solanacearum (strain GMI1000) GN=gpsA PE=3 SV=1 213 362 7.0E-10
sp|P9WN77|GPDA_MYCTU Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=gpsA PE=1 SV=1 213 375 7.0E-10
sp|A6Q3B2|GPDA_NITSB Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Nitratiruptor sp. (strain SB155-2) GN=gpsA PE=3 SV=1 225 365 7.0E-10
sp|Q491Y0|GPDA_BLOPB Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Blochmannia pennsylvanicus (strain BPEN) GN=gpsA PE=3 SV=1 218 370 8.0E-10
sp|B0B8U0|GPDA_CHLT2 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=gpsA PE=3 SV=1 213 362 8.0E-10
sp|B0BAG9|GPDA_CHLTB Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=gpsA PE=3 SV=1 213 362 8.0E-10
sp|C3PFZ8|GPDA_CORA7 Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1) GN=gpsA PE=3 SV=1 18 145 1.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor Yes
GO:0046168 glycerol-3-phosphate catabolic process Yes
GO:0004367 glycerol-3-phosphate dehydrogenase [NAD+] activity Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0051287 NAD binding Yes
GO:0052646 alditol phosphate metabolic process No
GO:0009987 cellular process No
GO:0071704 organic substance metabolic process No
GO:0006793 phosphorus metabolic process No
GO:0003674 molecular_function No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0016491 oxidoreductase activity No
GO:0044238 primary metabolic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0016614 oxidoreductase activity, acting on CH-OH group of donors No
GO:0047952 glycerol-3-phosphate dehydrogenase [NAD(P)+] activity No
GO:0008150 biological_process No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0009056 catabolic process No
GO:0046434 organophosphate catabolic process No
GO:0000166 nucleotide binding No
GO:0019637 organophosphate metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0036094 small molecule binding No
GO:1901135 carbohydrate derivative metabolic process No
GO:0006072 glycerol-3-phosphate metabolic process No
GO:1901575 organic substance catabolic process No
GO:0003824 catalytic activity No
GO:1901136 carbohydrate derivative catabolic process No
GO:1901265 nucleoside phosphate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|34
MWVFEEDVVIPKGSKHYDAAIGERPQKLTSVINSLHENVKYLPGITLPSNIVANPSIVDAVADSTILIFNLPHQF
IGKVCEQIRGHILPYARGISCIKGVNVSDDDVSLFSEWIGDGLSIYVGALSGANIANEIAAEKWSETTIAYDPPP
MDSRAPSPRSGSPMPSPGLVLTEPPTDGHHHHRDARGRTSKTRLTPVPAQYPPLEHECFRLLFHRPYFHVQMVSD
VAGVSLGGALKNIVALAAGFVDGRGWGDNAKAAIMRIGLMEMVKFGKEFFGETVQSSTFTETSAGVADLITSCSG
GRNFRCARKAVGMGVSVDEVEKQDLNGQKLQGTTTAYEVNSFLQRRGLEKDYPLFTAVNDILRGKKQVDDIPRLV
AVVDED
Coding >Ophio5|34
ATGTGGGTGTTTGAGGAGGACGTCGTCATTCCCAAGGGGTCCAAGCACTACGATGCCGCAATCGGCGAGCGACCT
CAGAAGCTCACGTCCGTCATCAATTCGTTGCACGAAAACGTCAAGTATCTGCCTGGCATCACGCTGCCGTCCAAC
ATCGTGGCTAATCCGTCCATCGTCGACGCCGTCGCCGACTCGACCATCCTCATCTTCAACCTGCCACACCAGTTT
ATCGGCAAGGTCTGCGAGCAAATCCGCGGCCACATTCTGCCCTATGCGCGCGGCATCAGCTGCATAAAGGGCGTC
AACGTCTCCGACGACGATGTCAGCCTCTTCAGCGAGTGGATCGGGGACGGCCTGAGCATCTACGTCGGCGCACTG
AGCGGCGCCAATATTGCCAACGAGATCGCCGCCGAGAAATGGTCCGAAACCACCATTGCCTACGACCCGCCCCCC
ATGGACAGCCGCGCGCCCTCGCCGCGGTCAGGCAGCCCGATGCCCAGCCCCGGCCTCGTCCTGACCGAGCCGCCA
ACCGACGGCCACCACCACCACCGCGATGCCCGGGGCCGAACCTCCAAGACGCGGCTAACGCCCGTGCCGGCGCAG
TACCCGCCCCTGGAACACGAGTGCTTCCGCCTCCTCTTCCACCGGCCATACTTCCACGTGCAGATGGTGTCAGAC
GTGGCCGGCGTGTCGCTTGGTGGCGCCCTCAAGAACATCGTCGCCTTGGCCGCCGGCTTCGTCGACGGCCGCGGC
TGGGGTGACAACGCAAAGGCTGCCATCATGCGCATCGGCCTCATGGAGATGGTCAAGTTTGGCAAAGAGTTTTTC
GGCGAGACGGTTCAGAGTAGCACCTTCACCGAGACGTCGGCCGGCGTCGCCGACCTCATCACCTCGTGCTCCGGC
GGACGCAACTTTCGTTGTGCCCGCAAGGCCGTCGGCATGGGCGTCTCTGTCGACGAGGTCGAGAAGCAGGACCTC
AACGGCCAGAAGCTGCAGGGGACGACGACGGCGTACGAGGTCAACAGCTTCCTTCAGAGGCGGGGACTCGAGAAG
GACTATCCTCTCTTTACGGCGGTCAATGACATTTTGCGGGGCAAGAAGCAGGTCGACGACATTCCGCGGCTCGTG
GCCGTGGTCGACGAGGAC
Transcript >Ophio5|34
ATGTGGGTGTTTGAGGAGGACGTCGTCATTCCCAAGGGGTCCAAGCACTACGATGCCGCAATCGGCGAGCGACCT
CAGAAGCTCACGTCCGTCATCAATTCGTTGCACGAAAACGTCAAGTATCTGCCTGGCATCACGCTGCCGTCCAAC
ATCGTGGCTAATCCGTCCATCGTCGACGCCGTCGCCGACTCGACCATCCTCATCTTCAACCTGCCACACCAGTTT
ATCGGCAAGGTCTGCGAGCAAATCCGCGGCCACATTCTGCCCTATGCGCGCGGCATCAGCTGCATAAAGGGCGTC
AACGTCTCCGACGACGATGTCAGCCTCTTCAGCGAGTGGATCGGGGACGGCCTGAGCATCTACGTCGGCGCACTG
AGCGGCGCCAATATTGCCAACGAGATCGCCGCCGAGAAATGGTCCGAAACCACCATTGCCTACGACCCGCCCCCC
ATGGACAGCCGCGCGCCCTCGCCGCGGTCAGGCAGCCCGATGCCCAGCCCCGGCCTCGTCCTGACCGAGCCGCCA
ACCGACGGCCACCACCACCACCGCGATGCCCGGGGCCGAACCTCCAAGACGCGGCTAACGCCCGTGCCGGCGCAG
TACCCGCCCCTGGAACACGAGTGCTTCCGCCTCCTCTTCCACCGGCCATACTTCCACGTGCAGATGGTGTCAGAC
GTGGCCGGCGTGTCGCTTGGTGGCGCCCTCAAGAACATCGTCGCCTTGGCCGCCGGCTTCGTCGACGGCCGCGGC
TGGGGTGACAACGCAAAGGCTGCCATCATGCGCATCGGCCTCATGGAGATGGTCAAGTTTGGCAAAGAGTTTTTC
GGCGAGACGGTTCAGAGTAGCACCTTCACCGAGACGTCGGCCGGCGTCGCCGACCTCATCACCTCGTGCTCCGGC
GGACGCAACTTTCGTTGTGCCCGCAAGGCCGTCGGCATGGGCGTCTCTGTCGACGAGGTCGAGAAGCAGGACCTC
AACGGCCAGAAGCTGCAGGGGACGACGACGGCGTACGAGGTCAACAGCTTCCTTCAGAGGCGGGGACTCGAGAAG
GACTATCCTCTCTTTACGGCGGTCAATGACATTTTGCGGGGCAAGAAGCAGGTCGACGACATTCCGCGGCTCGTG
GCCGTGGTCGACGAGGACTGA
Gene >Ophio5|34
ATGTGGGTGTTTGAGGAGGACGTCGTCATTCCCAAGGGGTCCAAGCACTACGATGCCGCAATCGGCGAGCGACCT
CAGAAGCTCACGTCCGTCATCAATTCGTTGCACGAAAACGTCAAGTATCTGCCTGGCATCACGCTGCCGTCCAAC
ATCGTGGCTAATCCGTCCATCGTCGACGCCGTCGCCGACTCGACCATCCTCATCTTCAACCTGCCACACCAGTTT
ATCGGCAAGGTCTGCGAGCAAATCCGCGGCCACATTCTGCCCTATGCGCGCGGCATCAGCTGCATAAAGGGCGTC
AACGTCTCCGACGACGATGTCAGCCTCTTCAGCGAGTGGATCGGGGACGGCCTGAGCATCTACGTCGGCGCACTG
AGCGGCGCCAATATTGCCAACGAGATCGCCGCCGAGAAATGGTCCGAAACCACCATTGCCTACGACCCGCCCCCC
ATGGACAGCCGCGCGCCCTCGCCGCGGTCAGGCAGCCCGATGCCCAGCCCCGGCCTCGTCCTGACCGAGCCGCCA
ACCGACGGCCACCACCACCACCGCGATGCCCGGGGCCGAACCTCCAAGACGCGGCTAACGCCCGTGCCGGCGCAG
TACCCGCCCCTGGAACACGAGTGCTTCCGCCTCCTCTTCCACCGGCCATACTTCCACGTGCAGATGGTGTCAGAC
GTGGCCGGCGTGTCGCTTGGTGGCGCCCTCAAGAACATCGTCGCCTTGGCCGCCGGCTTCGTCGACGGCCGCGGC
TGGGGTGACAACGCAAAGGCTGCCATCATGCGCATCGGCCTCATGGAGATGGTCAAGTTTGGCAAAGAGTTTTTC
GGCGAGACGGTTCAGAGTAGCACCTTCACCGAGACGTCGGCCGGCGTCGCCGACCTCATCACCTCGTGCTCCGGC
GGACGCAACTTTCGTTGTGCCCGCAAGGCCGTCGGCATGGGCGTCTCTGTCGACGAGGTCGAGAAGCAGGACCTC
AACGGCCAGAAGCTGCAGGGGACGACGACGGCGTACGAGGTCAACAGCTTCCTTCAGAGGCGGGGACTCGAGAAG
GACTATCCTCTCTTTACGGCGGTCAATGACATTTTGCGGGGCAAGAAGCAGGTCGACGACATTCCGCGGCTCGTG
GCCGTGGTCGACGAGGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail