Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3399
Gene name
Locationscaffold_27:37602..38214
Strand-
Gene length (bp)612
Transcript length (bp)534
Coding sequence length (bp)531
Protein length (aa) 177

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07366 SnoaL SnoaL-like polyketide cyclase 3.6E-11 52 163

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0030638 polyketide metabolic process Yes
GO:0019748 secondary metabolic process No
GO:0071704 organic substance metabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3399
MQPIHILNLISRLPVLRQVYRSVPYKAGRLARMKCSGPTCSRDFARFLTTKAYVAYVDALNKRPFPGLADFVNST
VTLNGTSMPLADFEKLLTDDMDAAPDLQWETSMLVVDEAKQRVGCRIEFRCTPQREFMGRNIQGTVTCMEHMFYQ
YESGKISDVWWMPGELVSAESSGNFAK
Coding >Ophio5|3399
ATGCAGCCTATCCACATTCTGAATCTAATCTCCCGCTTGCCCGTCCTCCGGCAGGTCTACAGATCTGTGCCATAT
AAAGCAGGCCGCTTGGCTCGCATGAAATGTTCAGGCCCTACATGTTCAAGAGATTTTGCCCGCTTCCTGACAACG
AAAGCTTACGTTGCCTACGTGGACGCCCTCAACAAGAGGCCCTTCCCCGGTCTAGCAGACTTTGTCAATTCCACC
GTCACATTGAACGGAACCTCGATGCCCCTTGCCGACTTTGAGAAGCTCCTCACGGACGATATGGACGCGGCTCCG
GACCTGCAGTGGGAAACGTCAATGCTTGTCGTTGACGAAGCCAAACAACGCGTTGGTTGCAGGATTGAGTTCAGG
TGCACCCCTCAGCGAGAGTTCATGGGCCGCAACATACAGGGCACAGTTACGTGTATGGAGCACATGTTCTACCAG
TACGAAAGCGGCAAGATTTCTGATGTGTGGTGGATGCCGGGGGAACTCGTGTCTGCGGAGTCCAGCGGGAACTTT
GCCAAG
Transcript >Ophio5|3399
ATGCAGCCTATCCACATTCTGAATCTAATCTCCCGCTTGCCCGTCCTCCGGCAGGTCTACAGATCTGTGCCATAT
AAAGCAGGCCGCTTGGCTCGCATGAAATGTTCAGGCCCTACATGTTCAAGAGATTTTGCCCGCTTCCTGACAACG
AAAGCTTACGTTGCCTACGTGGACGCCCTCAACAAGAGGCCCTTCCCCGGTCTAGCAGACTTTGTCAATTCCACC
GTCACATTGAACGGAACCTCGATGCCCCTTGCCGACTTTGAGAAGCTCCTCACGGACGATATGGACGCGGCTCCG
GACCTGCAGTGGGAAACGTCAATGCTTGTCGTTGACGAAGCCAAACAACGCGTTGGTTGCAGGATTGAGTTCAGG
TGCACCCCTCAGCGAGAGTTCATGGGCCGCAACATACAGGGCACAGTTACGTGTATGGAGCACATGTTCTACCAG
TACGAAAGCGGCAAGATTTCTGATGTGTGGTGGATGCCGGGGGAACTCGTGTCTGCGGAGTCCAGCGGGAACTTT
GCCAAGTAG
Gene >Ophio5|3399
ATGCAGCCTATCCACATTCTGAATCTAATCTCCCGCTTGCCCGTCCTCCGGCAGGTCTACAGATCTGTGCCATAT
AAAGCAGGCCGCTTGGCTCGCATGAAATGTTCAGGCCCTACATGTTCAAGAGATTTTGCCCGCTTCCTGACAACG
AAAGCTGTGAGTAAACAGCCATTGCTACATGCAAACACAACACCAGTCCTCATCATGACTTCGCCATCCTCGCTG
GAACAAAAGTACGTTGCCTACGTGGACGCCCTCAACAAGAGGCCCTTCCCCGGTCTAGCAGACTTTGTCAATTCC
ACCGTCACATTGAACGGAACCTCGATGCCCCTTGCCGACTTTGAGAAGCTCCTCACGGACGATATGGACGCGGCT
CCGGACCTGCAGTGGGAAACGTCAATGCTTGTCGTTGACGAAGCCAAACAACGCGTTGGTTGCAGGATTGAGTTC
AGGTGCACCCCTCAGCGAGAGTTCATGGGCCGCAACATACAGGGCACAGTTACGTGTATGGAGCACATGTTCTAC
CAGTACGAAAGCGGCAAGATTTCTGATGTGTGGTGGATGCCGGGGGAACTCGTGTCTGCGGAGTCCAGCGGGAAC
TTTGCCAAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail