Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3397
Gene name
Locationscaffold_27:32914..34038
Strand-
Gene length (bp)1124
Transcript length (bp)939
Coding sequence length (bp)936
Protein length (aa) 312

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13460 NAD_binding_10 NAD(P)H-binding 1.2E-06 14 153
PF02254 TrkA_N TrkA-N domain 5.0E-06 8 82

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|E1U332|ALL12_OLEEU Isoflavone reductase-like protein OS=Olea europaea PE=1 SV=1 1 250 1.0E-08
sp|P52578|IFRH_SOLTU Isoflavone reductase homolog OS=Solanum tuberosum PE=2 SV=1 1 251 2.0E-08
sp|O65679|PILR3_ARATH Probable pinoresinol-lariciresinol reductase 3 OS=Arabidopsis thaliana GN=PLR3 PE=3 SV=2 6 269 2.0E-07
sp|P52576|IFR_PEA Isoflavone reductase OS=Pisum sativum GN=IFR PE=2 SV=1 1 265 1.0E-06

GO

GO Term Description Terminal node
GO:0006813 potassium ion transport Yes
GO:0006812 cation transport No
GO:0006811 ion transport No
GO:0051234 establishment of localization No
GO:0006810 transport No
GO:0030001 metal ion transport No
GO:0051179 localization No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 1.22 0.00 2.56
CcL In ants, during behavior modification 224.81 33.07 416.55
CcD In ants, recently dead 66.75 35.00 98.50

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.000286 yes
SC16a CcD 0.000286 yes
CcL CcD 0.001217 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3397
MADTQQIIALCSVGNLGKYLCDELLADGRYKFFVISRQSNKAAFFQDRNIDVRTSDYSKESILEILNQTNASALI
SFNNSDGQTFVDVHRAFLDACRLSSNCKRFIPSEFAGNIDDFPLSPSYFEESRVPFRKILEKEEEVEWTIFNNGW
LMDYFLTADKSYMPSIPKEFPVDPNGWRACIRGTGEQVQSFTSGRDVAKALIMLLDAPEWERTTYVTGQWSTFNE
MVKSMEVFYGRPMEKTYRSEEDIHRDTLLPPTAENYEALYLASVEEMMLTASGACPRDKTMRQREKFFRGLNFIT
LEELLLQSQSKI
Coding >Ophio5|3397
ATGGCTGATACACAACAAATCATTGCTCTATGCTCTGTAGGAAACCTCGGCAAGTACCTCTGCGATGAATTGCTC
GCCGACGGCCGCTACAAGTTTTTCGTCATCTCCCGTCAATCCAACAAAGCGGCGTTTTTTCAGGACCGCAACATA
GATGTGCGCACGAGCGACTACAGCAAGGAATCGATTCTGGAGATTTTGAACCAGACTAATGCCAGTGCCCTGATA
TCCTTCAACAACAGCGATGGCCAAACCTTTGTTGATGTGCACCGCGCCTTTTTGGACGCTTGTCGCTTGTCATCG
AATTGCAAGCGATTCATTCCCTCCGAATTCGCCGGCAACATCGATGATTTTCCGCTTTCTCCGAGCTACTTTGAG
GAATCAAGAGTACCGTTTCGGAAAATTCTTGAAAAAGAGGAGGAAGTCGAGTGGACAATCTTTAACAACGGCTGG
CTGATGGATTACTTCTTGACCGCTGACAAGTCATACATGCCCTCGATCCCAAAGGAATTCCCAGTTGACCCAAAT
GGCTGGAGGGCGTGTATTAGGGGAACCGGAGAACAGGTGCAATCCTTTACAAGCGGTCGAGATGTGGCCAAGGCG
CTCATAATGCTGCTCGACGCGCCAGAATGGGAACGCACAACTTATGTCACAGGCCAGTGGTCTACATTCAATGAA
ATGGTCAAGTCTATGGAAGTGTTTTATGGCCGACCGATGGAGAAGACATACAGGTCGGAAGAGGACATTCATCGC
GATACTTTGCTGCCCCCGACGGCGGAAAACTATGAAGCTCTCTACCTCGCAAGTGTAGAGGAGATGATGCTTACA
GCCTCGGGCGCATGTCCTCGGGACAAGACCATGCGGCAGAGAGAAAAATTCTTTCGTGGACTCAACTTCATCACC
CTGGAGGAGCTTTTATTACAGTCGCAGTCCAAGATT
Transcript >Ophio5|3397
ATGGCTGATACACAACAAATCATTGCTCTATGCTCTGTAGGAAACCTCGGCAAGTACCTCTGCGATGAATTGCTC
GCCGACGGCCGCTACAAGTTTTTCGTCATCTCCCGTCAATCCAACAAAGCGGCGTTTTTTCAGGACCGCAACATA
GATGTGCGCACGAGCGACTACAGCAAGGAATCGATTCTGGAGATTTTGAACCAGACTAATGCCAGTGCCCTGATA
TCCTTCAACAACAGCGATGGCCAAACCTTTGTTGATGTGCACCGCGCCTTTTTGGACGCTTGTCGCTTGTCATCG
AATTGCAAGCGATTCATTCCCTCCGAATTCGCCGGCAACATCGATGATTTTCCGCTTTCTCCGAGCTACTTTGAG
GAATCAAGAGTACCGTTTCGGAAAATTCTTGAAAAAGAGGAGGAAGTCGAGTGGACAATCTTTAACAACGGCTGG
CTGATGGATTACTTCTTGACCGCTGACAAGTCATACATGCCCTCGATCCCAAAGGAATTCCCAGTTGACCCAAAT
GGCTGGAGGGCGTGTATTAGGGGAACCGGAGAACAGGTGCAATCCTTTACAAGCGGTCGAGATGTGGCCAAGGCG
CTCATAATGCTGCTCGACGCGCCAGAATGGGAACGCACAACTTATGTCACAGGCCAGTGGTCTACATTCAATGAA
ATGGTCAAGTCTATGGAAGTGTTTTATGGCCGACCGATGGAGAAGACATACAGGTCGGAAGAGGACATTCATCGC
GATACTTTGCTGCCCCCGACGGCGGAAAACTATGAAGCTCTCTACCTCGCAAGTGTAGAGGAGATGATGCTTACA
GCCTCGGGCGCATGTCCTCGGGACAAGACCATGCGGCAGAGAGAAAAATTCTTTCGTGGACTCAACTTCATCACC
CTGGAGGAGCTTTTATTACAGTCGCAGTCCAAGATTTAG
Gene >Ophio5|3397
ATGGCTGATACACAACAAATCATTGCTCTATGCTCTGTAGGAAACCTCGGCAAGTACCTCTGCGATGAATTGCTC
GCCGACGGCCGCTACAAGTTTTTCGTCATCTCCCGTCAAGTGAGTCTCAGTTATCTCAGTTATAGACATATAACA
GGTTTTTGGTTGACCTCTTTCTAACGTGATCAAGTCCAACAAAGCGGCGTTTTTTCAGGACCGCAACATAGATGT
GCGCACGAGCGACTACAGCAAGGAATCGATTCTGGAGATTTTGAACCAGACTAATGCCAGTGCCCTGATATCCTT
CAACAACAGCGATGGCCAAACCTTTGTTGATGTGCACCGCGCCTTTTTGGACGCTTGTCGCTTGTCATCGAATTG
CAAGCGATTCATTCCCTCCGAATTCGCCGGCAACATCGATGATTTTCCGCTTTCTCCGAGCTACTTTGAGGAATC
AAGAGTACCGTTTCGGAAAATTCTTGAAAAAGAGGAGGAAGTCGAGTGGACAATCTTTAACAACGGCTGGCTGAT
GGATTACTTCTTGACCGCTGACAAGTCATACATGCCCTCGATCCCAAAGGAATTCCCAGTTGACCCAAATGGCTG
GAGGGCGTGTATTAGGGGAACCGGAGAACAGGTGCAATCCTTTACAAGCGGTCGAGATGTGGCCAAGGCGCTCAT
AATGCTGCTCGACGCGCCAGAATGGGTCAGTCACATACTCGAAGACGATAGTGTGTGTCTACGTCTGCTTAACGT
CTACTTACCAGGAACGCACAACTTATGTCACAGGCCAGTGGTCTACATTCAATGAAATGGTCAAGTCTATGGAAG
TGTTTTATGGTTTGTCTTAGACTCCCATTTCGGGAAAGACTGCTTGGCTAAGACGAGTTCTAGGCCGACCGATGG
AGAAGACATACAGGTCGGAAGAGGACATTCATCGCGATACTTTGCTGCCCCCGACGGCGGAAAACTATGAAGCTC
TCTACCTCGCAAGTGTAGAGGAGATGATGCTTACAGCCTCGGGCGCATGTCCTCGGGACAAGACCATGCGGCAGA
GAGAAAAATTCTTTCGTGGACTCAACTTCATCACCCTGGAGGAGCTTTTATTACAGTCGCAGTCCAAGATTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail