Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3397
Gene name
Locationscaffold_27:32914..34038
Strand-
Gene length (bp)1124
Transcript length (bp)939
Coding sequence length (bp)936
Protein length (aa) 312

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13460 NAD_binding_10 NAD(P)H-binding 1.2E-06 14 153
PF02254 TrkA_N TrkA-N domain 5.0E-06 8 82

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|E1U332|ALL12_OLEEU Isoflavone reductase-like protein OS=Olea europaea PE=1 SV=1 1 250 1.0E-08
sp|P52578|IFRH_SOLTU Isoflavone reductase homolog OS=Solanum tuberosum PE=2 SV=1 1 251 2.0E-08
sp|O65679|PILR3_ARATH Probable pinoresinol-lariciresinol reductase 3 OS=Arabidopsis thaliana GN=PLR3 PE=3 SV=2 6 269 2.0E-07
sp|P52576|IFR_PEA Isoflavone reductase OS=Pisum sativum GN=IFR PE=2 SV=1 1 265 1.0E-06

GO

GO Term Description Terminal node
GO:0006813 potassium ion transport Yes
GO:0006812 cation transport No
GO:0006811 ion transport No
GO:0051234 establishment of localization No
GO:0006810 transport No
GO:0030001 metal ion transport No
GO:0051179 localization No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3397
MADTQQIIALCSVGNLGKYLCDELLADGRYKFFVISRQSNKAAFFQDRNIDVRTSDYSKESILEILNQTNASALI
SFNNSDGQTFVDVHRAFLDACRLSSNCKRFIPSEFAGNIDDFPLSPSYFEESRVPFRKILEKEEEVEWTIFNNGW
LMDYFLTADKSYMPSIPKEFPVDPNGWRACIRGTGEQVQSFTSGRDVAKALIMLLDAPEWERTTYVTGQWSTFNE
MVKSMEVFYGRPMEKTYRSEEDIHRDTLLPPTAENYEALYLASVEEMMLTASGACPRDKTMRQREKFFRGLNFIT
LEELLLQSQSKI
Coding >Ophio5|3397
ATGGCTGATACACAACAAATCATTGCTCTATGCTCTGTAGGAAACCTCGGCAAGTACCTCTGCGATGAATTGCTC
GCCGACGGCCGCTACAAGTTTTTCGTCATCTCCCGTCAATCCAACAAAGCGGCGTTTTTTCAGGACCGCAACATA
GATGTGCGCACGAGCGACTACAGCAAGGAATCGATTCTGGAGATTTTGAACCAGACTAATGCCAGTGCCCTGATA
TCCTTCAACAACAGCGATGGCCAAACCTTTGTTGATGTGCACCGCGCCTTTTTGGACGCTTGTCGCTTGTCATCG
AATTGCAAGCGATTCATTCCCTCCGAATTCGCCGGCAACATCGATGATTTTCCGCTTTCTCCGAGCTACTTTGAG
GAATCAAGAGTACCGTTTCGGAAAATTCTTGAAAAAGAGGAGGAAGTCGAGTGGACAATCTTTAACAACGGCTGG
CTGATGGATTACTTCTTGACCGCTGACAAGTCATACATGCCCTCGATCCCAAAGGAATTCCCAGTTGACCCAAAT
GGCTGGAGGGCGTGTATTAGGGGAACCGGAGAACAGGTGCAATCCTTTACAAGCGGTCGAGATGTGGCCAAGGCG
CTCATAATGCTGCTCGACGCGCCAGAATGGGAACGCACAACTTATGTCACAGGCCAGTGGTCTACATTCAATGAA
ATGGTCAAGTCTATGGAAGTGTTTTATGGCCGACCGATGGAGAAGACATACAGGTCGGAAGAGGACATTCATCGC
GATACTTTGCTGCCCCCGACGGCGGAAAACTATGAAGCTCTCTACCTCGCAAGTGTAGAGGAGATGATGCTTACA
GCCTCGGGCGCATGTCCTCGGGACAAGACCATGCGGCAGAGAGAAAAATTCTTTCGTGGACTCAACTTCATCACC
CTGGAGGAGCTTTTATTACAGTCGCAGTCCAAGATT
Transcript >Ophio5|3397
ATGGCTGATACACAACAAATCATTGCTCTATGCTCTGTAGGAAACCTCGGCAAGTACCTCTGCGATGAATTGCTC
GCCGACGGCCGCTACAAGTTTTTCGTCATCTCCCGTCAATCCAACAAAGCGGCGTTTTTTCAGGACCGCAACATA
GATGTGCGCACGAGCGACTACAGCAAGGAATCGATTCTGGAGATTTTGAACCAGACTAATGCCAGTGCCCTGATA
TCCTTCAACAACAGCGATGGCCAAACCTTTGTTGATGTGCACCGCGCCTTTTTGGACGCTTGTCGCTTGTCATCG
AATTGCAAGCGATTCATTCCCTCCGAATTCGCCGGCAACATCGATGATTTTCCGCTTTCTCCGAGCTACTTTGAG
GAATCAAGAGTACCGTTTCGGAAAATTCTTGAAAAAGAGGAGGAAGTCGAGTGGACAATCTTTAACAACGGCTGG
CTGATGGATTACTTCTTGACCGCTGACAAGTCATACATGCCCTCGATCCCAAAGGAATTCCCAGTTGACCCAAAT
GGCTGGAGGGCGTGTATTAGGGGAACCGGAGAACAGGTGCAATCCTTTACAAGCGGTCGAGATGTGGCCAAGGCG
CTCATAATGCTGCTCGACGCGCCAGAATGGGAACGCACAACTTATGTCACAGGCCAGTGGTCTACATTCAATGAA
ATGGTCAAGTCTATGGAAGTGTTTTATGGCCGACCGATGGAGAAGACATACAGGTCGGAAGAGGACATTCATCGC
GATACTTTGCTGCCCCCGACGGCGGAAAACTATGAAGCTCTCTACCTCGCAAGTGTAGAGGAGATGATGCTTACA
GCCTCGGGCGCATGTCCTCGGGACAAGACCATGCGGCAGAGAGAAAAATTCTTTCGTGGACTCAACTTCATCACC
CTGGAGGAGCTTTTATTACAGTCGCAGTCCAAGATTTAG
Gene >Ophio5|3397
ATGGCTGATACACAACAAATCATTGCTCTATGCTCTGTAGGAAACCTCGGCAAGTACCTCTGCGATGAATTGCTC
GCCGACGGCCGCTACAAGTTTTTCGTCATCTCCCGTCAAGTGAGTCTCAGTTATCTCAGTTATAGACATATAACA
GGTTTTTGGTTGACCTCTTTCTAACGTGATCAAGTCCAACAAAGCGGCGTTTTTTCAGGACCGCAACATAGATGT
GCGCACGAGCGACTACAGCAAGGAATCGATTCTGGAGATTTTGAACCAGACTAATGCCAGTGCCCTGATATCCTT
CAACAACAGCGATGGCCAAACCTTTGTTGATGTGCACCGCGCCTTTTTGGACGCTTGTCGCTTGTCATCGAATTG
CAAGCGATTCATTCCCTCCGAATTCGCCGGCAACATCGATGATTTTCCGCTTTCTCCGAGCTACTTTGAGGAATC
AAGAGTACCGTTTCGGAAAATTCTTGAAAAAGAGGAGGAAGTCGAGTGGACAATCTTTAACAACGGCTGGCTGAT
GGATTACTTCTTGACCGCTGACAAGTCATACATGCCCTCGATCCCAAAGGAATTCCCAGTTGACCCAAATGGCTG
GAGGGCGTGTATTAGGGGAACCGGAGAACAGGTGCAATCCTTTACAAGCGGTCGAGATGTGGCCAAGGCGCTCAT
AATGCTGCTCGACGCGCCAGAATGGGTCAGTCACATACTCGAAGACGATAGTGTGTGTCTACGTCTGCTTAACGT
CTACTTACCAGGAACGCACAACTTATGTCACAGGCCAGTGGTCTACATTCAATGAAATGGTCAAGTCTATGGAAG
TGTTTTATGGTTTGTCTTAGACTCCCATTTCGGGAAAGACTGCTTGGCTAAGACGAGTTCTAGGCCGACCGATGG
AGAAGACATACAGGTCGGAAGAGGACATTCATCGCGATACTTTGCTGCCCCCGACGGCGGAAAACTATGAAGCTC
TCTACCTCGCAAGTGTAGAGGAGATGATGCTTACAGCCTCGGGCGCATGTCCTCGGGACAAGACCATGCGGCAGA
GAGAAAAATTCTTTCGTGGACTCAACTTCATCACCCTGGAGGAGCTTTTATTACAGTCGCAGTCCAAGATTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail