Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3393
Gene name
Locationscaffold_27:24903..26354
Strand+
Gene length (bp)1451
Transcript length (bp)1386
Coding sequence length (bp)1383
Protein length (aa) 461

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13520 AA_permease_2 Amino acid permease 4.2E-39 3 425
PF00324 AA_permease Amino acid permease 2.1E-23 2 433

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O59813|YCT3_SCHPO Uncharacterized amino-acid permease C794.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.03 PE=2 SV=1 3 434 2.0E-62
sp|Q9UT18|THI9_SCHPO Thiamine transporter thi9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=thi9 PE=1 SV=1 4 432 1.0E-49
sp|Q9ZU50|BAT1_ARATH Amino-acid permease BAT1 OS=Arabidopsis thaliana GN=BAT1 PE=2 SV=2 1 449 4.0E-41
sp|B9EXZ6|BAT1_ORYSJ Amino-acid permease BAT1 homolog OS=Oryza sativa subsp. japonica GN=BAT1 PE=2 SV=1 4 454 2.0E-39
sp|O60113|YG64_SCHPO Uncharacterized amino-acid permease C15C4.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC15C4.04c PE=3 SV=1 3 460 9.0E-38
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O59813|YCT3_SCHPO Uncharacterized amino-acid permease C794.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.03 PE=2 SV=1 3 434 2.0E-62
sp|Q9UT18|THI9_SCHPO Thiamine transporter thi9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=thi9 PE=1 SV=1 4 432 1.0E-49
sp|Q9ZU50|BAT1_ARATH Amino-acid permease BAT1 OS=Arabidopsis thaliana GN=BAT1 PE=2 SV=2 1 449 4.0E-41
sp|B9EXZ6|BAT1_ORYSJ Amino-acid permease BAT1 homolog OS=Oryza sativa subsp. japonica GN=BAT1 PE=2 SV=1 4 454 2.0E-39
sp|O60113|YG64_SCHPO Uncharacterized amino-acid permease C15C4.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC15C4.04c PE=3 SV=1 3 460 9.0E-38
sp|Q9US40|YFZ1_SCHPO Uncharacterized amino-acid permease C1039.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1039.01 PE=3 SV=1 23 460 4.0E-35
sp|O74537|YCQ4_SCHPO Uncharacterized amino-acid permease C74.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC74.04 PE=3 SV=1 13 461 9.0E-35
sp|Q9C0Z0|YKM2_SCHPO Uncharacterized amino-acid permease PB24D3.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB24D3.02c PE=3 SV=1 8 459 2.0E-32
sp|Q10087|YAO8_SCHPO Uncharacterized amino-acid permease C11D3.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11D3.08c PE=3 SV=1 12 460 1.0E-29
sp|O59942|AAP2_NEUCR Amino-acid permease 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=aap-2 PE=2 SV=2 1 449 2.0E-29
sp|O74248|GPT1_CANAX Putative polyamine transporter OS=Candida albicans GN=GPT1 PE=3 SV=1 11 457 2.0E-27
sp|Q09887|YC9D_SCHPO Uncharacterized amino-acid permease C584.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC584.13 PE=3 SV=1 5 458 6.0E-26
sp|P32837|UGA4_YEAST GABA-specific permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UGA4 PE=1 SV=1 13 419 1.0E-25
sp|P19807|HNM1_YEAST Choline transport protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HNM1 PE=1 SV=1 1 460 3.0E-20
sp|P36029|TPO5_YEAST Polyamine transporter TPO5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO5 PE=1 SV=1 3 449 4.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0016020 membrane Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0110165 cellular anatomical entity No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 29 0.5

Transmembrane Domains

Domain # Start End Length
1 13 35 22
2 101 120 19
3 127 149 22
4 218 240 22
5 318 340 22
6 344 366 22
7 387 409 22
8 424 446 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3393
MRTGGPQAAFMSWTLVSIISCLLALSMAEIAAALPTAGGIYFWAYHLGGPKWGPFISWMTAWWNFAFWVLATPGT
QQGATNFLISALEINFPETAYLRQGWFQLLATLCGLLIALLPNVTSQRLLQLYFRFAIAMFFVLFFVFWIWFPIS
VQGRFQSPEFVFKKFYNGVNQGSSQQASDSYCWMISLLFGAWEFGGYDAAAHLAEETRHASKTVARGMWLSTVST
TILSIPTVVLILFCIQDFEALISAHYANNWAQFLVDVVGRRGATAILVMSWIDCTCSTAACLLSAQRVTFAISRD
NILPGSVWIKKVGGGNSIPVNAAIFVVSIAAAVSCSILGSTVAFSAITAATVSCQNMSYLFLLLTRHTLGRSRFK
PASWNLGSLSRVIGYITILWLSLLSVVLLLPQVFPVTMETLNYSPICLAFVTFVSVIGWHLPCGWGGRYWFKGPR
RTLSTAQSEET
Coding >Ophio5|3393
ATGAGAACGGGCGGGCCGCAAGCAGCTTTCATGTCATGGACCCTGGTCAGCATCATCTCATGCCTCCTGGCGCTA
TCCATGGCCGAGATCGCGGCAGCATTACCGACGGCTGGCGGAATTTACTTCTGGGCCTACCACCTCGGCGGCCCG
AAATGGGGGCCGTTTATCAGCTGGATGACTGCCTGGTGGAATTTTGCTTTTTGGGTGTTGGCTACCCCCGGCACG
CAGCAGGGTGCAACAAACTTTCTCATTTCAGCACTGGAAATCAACTTTCCAGAAACTGCATATCTCCGTCAAGGC
TGGTTCCAGCTCCTGGCTACCTTGTGTGGTCTGCTGATTGCCCTACTTCCCAATGTCACGAGTCAACGGTTGTTA
CAGCTATACTTTCGCTTTGCCATCGCCATGTTCTTTGTCTTGTTCTTCGTCTTCTGGATCTGGTTTCCCATCAGT
GTGCAAGGCCGGTTCCAATCTCCAGAGTTCGTCTTTAAGAAGTTTTACAACGGTGTTAATCAAGGCTCTTCCCAG
CAGGCCTCGGACTCTTATTGCTGGATGATTTCCTTGCTGTTCGGCGCTTGGGAGTTTGGCGGTTACGACGCCGCT
GCCCACTTGGCCGAGGAGACACGCCATGCCAGTAAAACAGTGGCTCGCGGAATGTGGCTCTCTACCGTCTCGACC
ACAATCCTCTCCATCCCGACCGTGGTACTGATCTTGTTCTGCATACAAGACTTTGAGGCCTTGATCTCTGCGCAT
TATGCCAATAACTGGGCGCAGTTTCTGGTCGACGTTGTGGGCCGACGCGGTGCAACCGCCATCCTGGTCATGAGC
TGGATCGACTGCACCTGTTCCACTGCCGCCTGTCTCCTATCAGCTCAACGCGTGACTTTTGCCATCTCTCGCGAC
AACATCTTGCCGGGGTCCGTGTGGATCAAAAAGGTTGGCGGTGGCAACTCGATACCAGTCAATGCCGCCATTTTC
GTCGTCTCGATTGCTGCTGCCGTCAGCTGCTCTATTCTGGGTTCAACTGTGGCATTCAGTGCTATTACAGCGGCA
ACCGTCAGCTGCCAGAACATGAGCTACCTGTTCCTCCTACTGACTCGACATACACTCGGCAGATCCCGGTTCAAG
CCAGCCTCGTGGAACCTGGGTTCCCTGTCTCGGGTGATAGGGTATATTACTATTCTCTGGCTGTCTTTGCTTTCC
GTCGTCCTTCTCCTACCACAGGTGTTCCCGGTTACAATGGAAACATTGAATTACTCTCCCATCTGTCTGGCATTC
GTCACGTTTGTGTCCGTGATTGGGTGGCATCTCCCTTGTGGTTGGGGTGGCCGCTATTGGTTCAAAGGGCCACGT
CGGACACTGTCCACTGCTCAATCCGAAGAGACC
Transcript >Ophio5|3393
ATGAGAACGGGCGGGCCGCAAGCAGCTTTCATGTCATGGACCCTGGTCAGCATCATCTCATGCCTCCTGGCGCTA
TCCATGGCCGAGATCGCGGCAGCATTACCGACGGCTGGCGGAATTTACTTCTGGGCCTACCACCTCGGCGGCCCG
AAATGGGGGCCGTTTATCAGCTGGATGACTGCCTGGTGGAATTTTGCTTTTTGGGTGTTGGCTACCCCCGGCACG
CAGCAGGGTGCAACAAACTTTCTCATTTCAGCACTGGAAATCAACTTTCCAGAAACTGCATATCTCCGTCAAGGC
TGGTTCCAGCTCCTGGCTACCTTGTGTGGTCTGCTGATTGCCCTACTTCCCAATGTCACGAGTCAACGGTTGTTA
CAGCTATACTTTCGCTTTGCCATCGCCATGTTCTTTGTCTTGTTCTTCGTCTTCTGGATCTGGTTTCCCATCAGT
GTGCAAGGCCGGTTCCAATCTCCAGAGTTCGTCTTTAAGAAGTTTTACAACGGTGTTAATCAAGGCTCTTCCCAG
CAGGCCTCGGACTCTTATTGCTGGATGATTTCCTTGCTGTTCGGCGCTTGGGAGTTTGGCGGTTACGACGCCGCT
GCCCACTTGGCCGAGGAGACACGCCATGCCAGTAAAACAGTGGCTCGCGGAATGTGGCTCTCTACCGTCTCGACC
ACAATCCTCTCCATCCCGACCGTGGTACTGATCTTGTTCTGCATACAAGACTTTGAGGCCTTGATCTCTGCGCAT
TATGCCAATAACTGGGCGCAGTTTCTGGTCGACGTTGTGGGCCGACGCGGTGCAACCGCCATCCTGGTCATGAGC
TGGATCGACTGCACCTGTTCCACTGCCGCCTGTCTCCTATCAGCTCAACGCGTGACTTTTGCCATCTCTCGCGAC
AACATCTTGCCGGGGTCCGTGTGGATCAAAAAGGTTGGCGGTGGCAACTCGATACCAGTCAATGCCGCCATTTTC
GTCGTCTCGATTGCTGCTGCCGTCAGCTGCTCTATTCTGGGTTCAACTGTGGCATTCAGTGCTATTACAGCGGCA
ACCGTCAGCTGCCAGAACATGAGCTACCTGTTCCTCCTACTGACTCGACATACACTCGGCAGATCCCGGTTCAAG
CCAGCCTCGTGGAACCTGGGTTCCCTGTCTCGGGTGATAGGGTATATTACTATTCTCTGGCTGTCTTTGCTTTCC
GTCGTCCTTCTCCTACCACAGGTGTTCCCGGTTACAATGGAAACATTGAATTACTCTCCCATCTGTCTGGCATTC
GTCACGTTTGTGTCCGTGATTGGGTGGCATCTCCCTTGTGGTTGGGGTGGCCGCTATTGGTTCAAAGGGCCACGT
CGGACACTGTCCACTGCTCAATCCGAAGAGACCTGA
Gene >Ophio5|3393
ATGAGAACGGGCGGGCCGCAAGCAGCTTTCATGTCATGGACCCTGGTCAGCATCATCTCATGCCTCCTGGCGCTA
TCCATGGCCGAGATCGCGGCAGCATTACCGACGGCTGGCGGAATTTACTTCTGGGCCTACCACCTCGGCGGCCCG
AAATGGGGGCCGTTTATCAGCTGGATGACTGCCGTACGCGCCATCAAACTCCCCCCCCAACAGAGAAACCAGGCT
TTGTCTGACGCTACGACTCTTAGTGGTGGAATTTTGCTTTTTGGGTGTTGGCTACCCCCGGCACGCAGCAGGGTG
CAACAAACTTTCTCATTTCAGCACTGGAAATCAACTTTCCAGAAACTGCATATCTCCGTCAAGGCTGGTTCCAGC
TCCTGGCTACCTTGTGTGGTCTGCTGATTGCCCTACTTCCCAATGTCACGAGTCAACGGTTGTTACAGCTATACT
TTCGCTTTGCCATCGCCATGTTCTTTGTCTTGTTCTTCGTCTTCTGGATCTGGTTTCCCATCAGTGTGCAAGGCC
GGTTCCAATCTCCAGAGTTCGTCTTTAAGAAGTTTTACAACGGTGTTAATCAAGGCTCTTCCCAGCAGGCCTCGG
ACTCTTATTGCTGGATGATTTCCTTGCTGTTCGGCGCTTGGGAGTTTGGCGGTTACGACGCCGCTGCCCACTTGG
CCGAGGAGACACGCCATGCCAGTAAAACAGTGGCTCGCGGAATGTGGCTCTCTACCGTCTCGACCACAATCCTCT
CCATCCCGACCGTGGTACTGATCTTGTTCTGCATACAAGACTTTGAGGCCTTGATCTCTGCGCATTATGCCAATA
ACTGGGCGCAGTTTCTGGTCGACGTTGTGGGCCGACGCGGTGCAACCGCCATCCTGGTCATGAGCTGGATCGACT
GCACCTGTTCCACTGCCGCCTGTCTCCTATCAGCTCAACGCGTGACTTTTGCCATCTCTCGCGACAACATCTTGC
CGGGGTCCGTGTGGATCAAAAAGGTTGGCGGTGGCAACTCGATACCAGTCAATGCCGCCATTTTCGTCGTCTCGA
TTGCTGCTGCCGTCAGCTGCTCTATTCTGGGTTCAACTGTGGCATTCAGTGCTATTACAGCGGCAACCGTCAGCT
GCCAGAACATGAGCTACCTGTTCCTCCTACTGACTCGACATACACTCGGCAGATCCCGGTTCAAGCCAGCCTCGT
GGAACCTGGGTTCCCTGTCTCGGGTGATAGGGTATATTACTATTCTCTGGCTGTCTTTGCTTTCCGTCGTCCTTC
TCCTACCACAGGTGTTCCCGGTTACAATGGAAACATTGAATTACTCTCCCATCTGTCTGGCATTCGTCACGTTTG
TGTCCGTGATTGGGTGGCATCTCCCTTGTGGTTGGGGTGGCCGCTATTGGTTCAAAGGGCCACGTCGGACACTGT
CCACTGCTCAATCCGAAGAGACCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail