Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3391
Gene name
Locationscaffold_27:18734..20666
Strand+
Gene length (bp)1932
Transcript length (bp)1737
Coding sequence length (bp)1734
Protein length (aa) 578

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 4.3E-23 65 395
PF00083 Sugar_tr Sugar (and other) transporter 1.2E-19 84 290

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9C101|YKT8_SCHPO Uncharacterized MFS-type transporter PB1E7.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB1E7.08c PE=1 SV=1 7 518 4.0E-70
sp|P30638|SVOP_CAEEL Putative transporter svop-1 OS=Caenorhabditis elegans GN=svop-1 PE=3 SV=5 38 519 7.0E-20
sp|Q9JIS5|SV2A_MOUSE Synaptic vesicle glycoprotein 2A OS=Mus musculus GN=Sv2a PE=1 SV=1 5 295 1.0E-16
sp|Q4R4X3|SV2A_MACFA Synaptic vesicle glycoprotein 2A OS=Macaca fascicularis GN=SV2A PE=2 SV=1 5 295 1.0E-16
sp|Q7L0J3|SV2A_HUMAN Synaptic vesicle glycoprotein 2A OS=Homo sapiens GN=SV2A PE=1 SV=1 5 295 1.0E-16
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9C101|YKT8_SCHPO Uncharacterized MFS-type transporter PB1E7.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB1E7.08c PE=1 SV=1 7 518 4.0E-70
sp|P30638|SVOP_CAEEL Putative transporter svop-1 OS=Caenorhabditis elegans GN=svop-1 PE=3 SV=5 38 519 7.0E-20
sp|Q9JIS5|SV2A_MOUSE Synaptic vesicle glycoprotein 2A OS=Mus musculus GN=Sv2a PE=1 SV=1 5 295 1.0E-16
sp|Q4R4X3|SV2A_MACFA Synaptic vesicle glycoprotein 2A OS=Macaca fascicularis GN=SV2A PE=2 SV=1 5 295 1.0E-16
sp|Q7L0J3|SV2A_HUMAN Synaptic vesicle glycoprotein 2A OS=Homo sapiens GN=SV2A PE=1 SV=1 5 295 1.0E-16
sp|Q02563|SV2A_RAT Synaptic vesicle glycoprotein 2A OS=Rattus norvegicus GN=Sv2a PE=1 SV=2 5 295 1.0E-16
sp|Q29397|SV2A_BOVIN Synaptic vesicle glycoprotein 2A OS=Bos taurus GN=SV2A PE=2 SV=1 51 295 2.0E-16
sp|Q5R4L9|SV2A_PONAB Synaptic vesicle glycoprotein 2A OS=Pongo abelii GN=SV2A PE=2 SV=1 38 295 7.0E-16
sp|Q69ZS6|SV2C_MOUSE Synaptic vesicle glycoprotein 2C OS=Mus musculus GN=Sv2c PE=1 SV=2 3 295 3.0E-15
sp|Q940M4|OCT7_ARATH Organic cation/carnitine transporter 7 OS=Arabidopsis thaliana GN=OCT7 PE=2 SV=1 43 572 6.0E-15
sp|Q9Z2I6|SV2C_RAT Synaptic vesicle glycoprotein 2C OS=Rattus norvegicus GN=Sv2c PE=1 SV=1 3 295 8.0E-15
sp|Q496J9|SV2C_HUMAN Synaptic vesicle glycoprotein 2C OS=Homo sapiens GN=SV2C PE=1 SV=1 3 295 1.0E-14
sp|Q2XWK0|SVOP_XENLA Synaptic vesicle 2-related protein OS=Xenopus laevis GN=svop PE=2 SV=1 42 293 8.0E-14
sp|Q1JP63|SVOP_BOVIN Synaptic vesicle 2-related protein OS=Bos taurus GN=SVOP PE=2 SV=1 42 293 8.0E-13
sp|Q8N4V2|SVOP_HUMAN Synaptic vesicle 2-related protein OS=Homo sapiens GN=SVOP PE=2 SV=1 42 293 8.0E-13
sp|Q5R5T8|SVOP_PONAB Synaptic vesicle 2-related protein OS=Pongo abelii GN=SVOP PE=2 SV=1 42 293 9.0E-13
sp|Q7L1I2|SV2B_HUMAN Synaptic vesicle glycoprotein 2B OS=Homo sapiens GN=SV2B PE=1 SV=1 31 295 3.0E-12
sp|Q8BG39|SV2B_MOUSE Synaptic vesicle glycoprotein 2B OS=Mus musculus GN=Sv2b PE=1 SV=1 47 295 4.0E-12
sp|Q63564|SV2B_RAT Synaptic vesicle glycoprotein 2B OS=Rattus norvegicus GN=Sv2b PE=1 SV=1 19 295 2.0E-11
sp|Q8BFT9|SVOP_MOUSE Synaptic vesicle 2-related protein OS=Mus musculus GN=Svop PE=1 SV=1 42 293 5.0E-11
sp|Q9Z2I7|SVOP_RAT Synaptic vesicle 2-related protein OS=Rattus norvegicus GN=Svop PE=1 SV=1 42 293 9.0E-11
sp|O34691|NAIP_BACSU Putative niacin/nicotinamide transporter NaiP OS=Bacillus subtilis (strain 168) GN=naiP PE=1 SV=1 62 207 3.0E-10
sp|Q43975|PCAK_ACIAD 4-hydroxybenzoate transporter PcaK OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=pcaK PE=1 SV=3 38 395 5.0E-10
sp|P37514|YYAJ_BACSU Putative metabolite transport protein YyaJ OS=Bacillus subtilis (strain 168) GN=yyaJ PE=3 SV=2 44 548 5.0E-10
sp|Q51955|PCAK_PSEPU 4-hydroxybenzoate transporter PcaK OS=Pseudomonas putida GN=pcaK PE=1 SV=1 43 183 3.0E-09
sp|P25297|PHO84_YEAST Inorganic phosphate transporter PHO84 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHO84 PE=1 SV=2 1 572 2.0E-07
sp|Q9I6Q3|PCAK_PSEAE 4-hydroxybenzoate transporter PcaK OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pcaK PE=3 SV=1 47 206 3.0E-07
sp|Q94DB8|PT111_ORYSJ Inorganic phosphate transporter 1-11 OS=Oryza sativa subsp. japonica GN=PHT1-11 PE=2 SV=1 24 309 3.0E-07
sp|Q8H6G8|PHT18_ORYSJ Probable inorganic phosphate transporter 1-8 OS=Oryza sativa subsp. japonica GN=PHT1-8 PE=2 SV=1 54 302 9.0E-07
sp|Q8H6G9|PHT17_ORYSJ Probable inorganic phosphate transporter 1-7 OS=Oryza sativa subsp. japonica GN=PHT1-7 PE=2 SV=1 54 201 1.0E-06
sp|Q9ZWT3|PHT16_ARATH Probable inorganic phosphate transporter 1-6 OS=Arabidopsis thaliana GN=PHT1-6 PE=1 SV=1 105 573 2.0E-06
sp|A7MJD1|NANT_CROS8 Putative sialic acid transporter OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=nanT PE=3 SV=1 52 177 2.0E-06
sp|Q8H6H0|PHT16_ORYSJ Inorganic phosphate transporter 1-6 OS=Oryza sativa subsp. japonica GN=PHT1-6 PE=1 SV=1 37 281 2.0E-06
sp|O48639|PHT13_ARATH Probable inorganic phosphate transporter 1-3 OS=Arabidopsis thaliana GN=PHT1-3 PE=2 SV=1 43 320 3.0E-06
sp|Q96303|PHT14_ARATH Inorganic phosphate transporter 1-4 OS=Arabidopsis thaliana GN=PHT1-4 PE=1 SV=1 47 310 5.0E-06
sp|Q5PLF0|NANT_SALPA Putative sialic acid transporter OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=nanT PE=3 SV=1 52 178 5.0E-06
sp|B5BGP4|NANT_SALPK Putative sialic acid transporter OS=Salmonella paratyphi A (strain AKU_12601) GN=nanT PE=3 SV=1 52 178 5.0E-06
sp|A9MNY7|NANT_SALAR Putative sialic acid transporter OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=nanT PE=3 SV=1 52 178 5.0E-06
sp|Q9SYQ1|PHT18_ARATH Probable inorganic phosphate transporter 1-8 OS=Arabidopsis thaliana GN=PHT1-8 PE=2 SV=2 45 203 5.0E-06
sp|A9N832|NANT_SALPB Putative sialic acid transporter OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=nanT PE=3 SV=1 52 178 6.0E-06
sp|Q9S735|PHT19_ARATH Probable inorganic phosphate transporter 1-9 OS=Arabidopsis thaliana GN=PHT1-9 PE=2 SV=1 54 294 6.0E-06
sp|B4TWI9|NANT_SALSV Putative sialic acid transporter OS=Salmonella schwarzengrund (strain CVM19633) GN=nanT PE=3 SV=1 52 178 6.0E-06
sp|Q57JD0|NANT_SALCH Putative sialic acid transporter OS=Salmonella choleraesuis (strain SC-B67) GN=nanT PE=3 SV=1 52 178 6.0E-06
sp|C0PZN3|NANT_SALPC Putative sialic acid transporter OS=Salmonella paratyphi C (strain RKS4594) GN=nanT PE=3 SV=1 52 178 6.0E-06
sp|B5F7J8|NANT_SALA4 Putative sialic acid transporter OS=Salmonella agona (strain SL483) GN=nanT PE=3 SV=1 52 178 6.0E-06
sp|B5FIR7|NANT_SALDC Putative sialic acid transporter OS=Salmonella dublin (strain CT_02021853) GN=nanT PE=3 SV=1 52 178 6.0E-06
sp|B5R0L1|NANT_SALEP Putative sialic acid transporter OS=Salmonella enteritidis PT4 (strain P125109) GN=nanT PE=3 SV=1 52 178 6.0E-06
sp|B5RET6|NANT_SALG2 Putative sialic acid transporter OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=nanT PE=3 SV=1 52 178 6.0E-06
sp|B4TJR2|NANT_SALHS Putative sialic acid transporter OS=Salmonella heidelberg (strain SL476) GN=nanT PE=3 SV=1 52 178 6.0E-06
sp|B4T749|NANT_SALNS Putative sialic acid transporter OS=Salmonella newport (strain SL254) GN=nanT PE=3 SV=1 52 178 6.0E-06
sp|P0A2G6|NANT_SALTI Putative sialic acid transporter OS=Salmonella typhi GN=nanT PE=3 SV=1 52 178 6.0E-06
sp|P0A2G5|NANT_SALTY Putative sialic acid transporter OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=nanT PE=3 SV=1 52 178 6.0E-06
sp|Q494P0|PHT17_ARATH Probable inorganic phosphate transporter 1-7 OS=Arabidopsis thaliana GN=PHT1-7 PE=2 SV=2 47 313 7.0E-06
sp|Q7XDZ7|PHT13_ORYSJ Probable inorganic phosphate transporter 1-3 OS=Oryza sativa subsp. japonica GN=PHT1-3 PE=2 SV=1 54 246 7.0E-06
sp|Q8H6H4|PHT11_ORYSJ Inorganic phosphate transporter 1-1 OS=Oryza sativa subsp. japonica GN=PHT1-1 PE=2 SV=1 54 246 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

Domain # Start End Length
1 58 80 22
2 95 117 22
3 124 146 22
4 150 172 22
5 185 207 22
6 242 264 22
7 369 391 22
8 411 433 22
9 534 553 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 5.55 1.84 9.26
CcL In ants, during behavior modification 0.64 0.00 1.36
CcD In ants, recently dead 1.51 0.17 2.85

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.000535 yes
SC16a CcD 0.001217 yes
CcL CcD 0.095075 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3391
MSSFGKPRAAASSAHLETADGRDMIDLSGLQHLPVYEQKCALVSRELDNQGMGRYQWYIWSLCGFGYFLDLLWAQ
AFALVLSPLQQELGFSNSQSGNISMSFNVGLTTGAFFWGFMSDIIGRRWAFNLTCLLSSVFGLCLGAANNYNTFL
VLTAFIGFGVGGNIPVDGTIFLEFAPQRRQYMLACLSVFQPLGVIACSAFAFAFIPTHSCSPNFSEPNPLPSCHN
VSTPGTPCCSREANMGWRYLLYTLGSLTLGVFILRTLIFKCRETPRFLIYRGQDARAMQTLEYVAKINRKKCQIS
LQLLDSLQNEYDLKQAREQSSPLSPLSPLSPLSPTENRTQFIPKTKTAKFGRELARFKLLFGTKRMTSLTVLTWL
TYMLDFGGFNIAGFYLPRILALKNGQESISLHHTYASYIYCYAPGILAVLLGAYASQIPALGQKWTMVASSALMG
TSIFLLSRVDSAAKSEGLFVLEYFFQSTFNAVLYAWTPQAFPAPIRGTACGVASFWGRLFGIVSPLIAQNLYGRA
SGNRGDVDSVLYLAGGVTMGCVLTTALLPRTVAEDEMQESTDSSYEPIASPRA
Coding >Ophio5|3391
ATGTCGAGCTTCGGCAAGCCCCGCGCCGCAGCCTCGTCGGCCCATCTGGAGACGGCGGACGGGCGAGACATGATC
GACTTGTCTGGGCTGCAGCATCTCCCCGTCTACGAGCAAAAGTGCGCCCTCGTCAGCCGCGAACTCGATAATCAG
GGCATGGGCCGATATCAGTGGTACATCTGGTCCCTGTGCGGCTTCGGCTACTTCCTCGACCTGCTATGGGCCCAG
GCATTCGCCCTCGTCCTCAGCCCGCTCCAGCAGGAGCTGGGCTTCTCCAACAGCCAGTCTGGAAATATATCCATG
AGCTTCAATGTGGGTCTCACGACCGGGGCTTTCTTCTGGGGCTTTATGTCCGACATCATCGGACGCCGATGGGCC
TTCAACTTGACCTGCCTCCTCTCCTCCGTCTTTGGCCTATGCCTCGGCGCCGCAAACAACTACAACACCTTTCTT
GTCTTGACGGCCTTTATTGGCTTCGGCGTTGGTGGCAACATTCCCGTTGATGGCACCATCTTCCTCGAGTTTGCT
CCGCAAAGGAGACAGTATATGCTGGCTTGTCTTTCCGTTTTCCAACCCTTGGGCGTAATTGCCTGCAGCGCCTTC
GCCTTCGCCTTTATACCCACGCATTCTTGCTCGCCCAACTTCTCCGAACCGAATCCGCTGCCGTCGTGTCACAAT
GTCTCGACGCCCGGAACTCCATGCTGCTCGCGGGAGGCCAACATGGGCTGGCGATATCTGCTCTACACGCTGGGT
TCCCTGACTCTCGGCGTCTTCATCCTACGAACCCTGATCTTCAAGTGTCGCGAGACGCCGAGATTTCTCATTTAT
CGAGGCCAGGACGCCAGGGCGATGCAAACGCTGGAATACGTGGCCAAGATTAACCGGAAAAAGTGCCAGATCTCT
CTACAGCTACTAGACTCTCTGCAGAATGAGTACGACTTGAAGCAGGCTCGGGAACAATCGAGCCCACTCAGCCCG
TTGAGCCCGCTGAGCCCGCTGAGCCCGACCGAGAACCGGACGCAATTCATACCAAAGACCAAAACGGCAAAGTTT
GGCCGCGAGTTGGCCAGGTTCAAGCTGCTTTTCGGCACCAAGCGGATGACAAGCCTGACTGTTTTGACCTGGCTC
ACATACATGCTCGACTTTGGCGGGTTTAACATAGCAGGCTTCTACCTGCCGCGAATCCTAGCACTGAAAAACGGC
CAGGAGTCGATTAGTCTGCACCACACGTACGCCTCCTACATCTACTGTTACGCACCGGGCATCCTCGCCGTCCTT
CTCGGTGCCTATGCCAGCCAGATCCCCGCCTTGGGTCAAAAGTGGACCATGGTGGCATCGTCGGCGTTAATGGGA
ACATCCATCTTCCTGCTTTCACGAGTCGACTCCGCCGCCAAGAGCGAGGGGTTGTTTGTGCTCGAGTACTTCTTC
CAGTCCACCTTCAACGCCGTCCTCTATGCCTGGACCCCGCAGGCGTTCCCGGCGCCGATTCGGGGCACGGCCTGT
GGAGTGGCCAGTTTCTGGGGGCGACTATTCGGAATCGTGAGTCCCTTGATTGCCCAGAACCTGTACGGGCGAGCA
TCCGGGAACCGCGGCGACGTGGACAGTGTTCTGTATCTAGCCGGAGGGGTTACTATGGGCTGTGTCTTGACTACG
GCTCTGTTGCCCAGGACTGTGGCCGAGGATGAGATGCAGGAGTCAACCGATTCCAGTTACGAGCCGATAGCCAGT
CCACGGGCA
Transcript >Ophio5|3391
ATGTCGAGCTTCGGCAAGCCCCGCGCCGCAGCCTCGTCGGCCCATCTGGAGACGGCGGACGGGCGAGACATGATC
GACTTGTCTGGGCTGCAGCATCTCCCCGTCTACGAGCAAAAGTGCGCCCTCGTCAGCCGCGAACTCGATAATCAG
GGCATGGGCCGATATCAGTGGTACATCTGGTCCCTGTGCGGCTTCGGCTACTTCCTCGACCTGCTATGGGCCCAG
GCATTCGCCCTCGTCCTCAGCCCGCTCCAGCAGGAGCTGGGCTTCTCCAACAGCCAGTCTGGAAATATATCCATG
AGCTTCAATGTGGGTCTCACGACCGGGGCTTTCTTCTGGGGCTTTATGTCCGACATCATCGGACGCCGATGGGCC
TTCAACTTGACCTGCCTCCTCTCCTCCGTCTTTGGCCTATGCCTCGGCGCCGCAAACAACTACAACACCTTTCTT
GTCTTGACGGCCTTTATTGGCTTCGGCGTTGGTGGCAACATTCCCGTTGATGGCACCATCTTCCTCGAGTTTGCT
CCGCAAAGGAGACAGTATATGCTGGCTTGTCTTTCCGTTTTCCAACCCTTGGGCGTAATTGCCTGCAGCGCCTTC
GCCTTCGCCTTTATACCCACGCATTCTTGCTCGCCCAACTTCTCCGAACCGAATCCGCTGCCGTCGTGTCACAAT
GTCTCGACGCCCGGAACTCCATGCTGCTCGCGGGAGGCCAACATGGGCTGGCGATATCTGCTCTACACGCTGGGT
TCCCTGACTCTCGGCGTCTTCATCCTACGAACCCTGATCTTCAAGTGTCGCGAGACGCCGAGATTTCTCATTTAT
CGAGGCCAGGACGCCAGGGCGATGCAAACGCTGGAATACGTGGCCAAGATTAACCGGAAAAAGTGCCAGATCTCT
CTACAGCTACTAGACTCTCTGCAGAATGAGTACGACTTGAAGCAGGCTCGGGAACAATCGAGCCCACTCAGCCCG
TTGAGCCCGCTGAGCCCGCTGAGCCCGACCGAGAACCGGACGCAATTCATACCAAAGACCAAAACGGCAAAGTTT
GGCCGCGAGTTGGCCAGGTTCAAGCTGCTTTTCGGCACCAAGCGGATGACAAGCCTGACTGTTTTGACCTGGCTC
ACATACATGCTCGACTTTGGCGGGTTTAACATAGCAGGCTTCTACCTGCCGCGAATCCTAGCACTGAAAAACGGC
CAGGAGTCGATTAGTCTGCACCACACGTACGCCTCCTACATCTACTGTTACGCACCGGGCATCCTCGCCGTCCTT
CTCGGTGCCTATGCCAGCCAGATCCCCGCCTTGGGTCAAAAGTGGACCATGGTGGCATCGTCGGCGTTAATGGGA
ACATCCATCTTCCTGCTTTCACGAGTCGACTCCGCCGCCAAGAGCGAGGGGTTGTTTGTGCTCGAGTACTTCTTC
CAGTCCACCTTCAACGCCGTCCTCTATGCCTGGACCCCGCAGGCGTTCCCGGCGCCGATTCGGGGCACGGCCTGT
GGAGTGGCCAGTTTCTGGGGGCGACTATTCGGAATCGTGAGTCCCTTGATTGCCCAGAACCTGTACGGGCGAGCA
TCCGGGAACCGCGGCGACGTGGACAGTGTTCTGTATCTAGCCGGAGGGGTTACTATGGGCTGTGTCTTGACTACG
GCTCTGTTGCCCAGGACTGTGGCCGAGGATGAGATGCAGGAGTCAACCGATTCCAGTTACGAGCCGATAGCCAGT
CCACGGGCATAG
Gene >Ophio5|3391
ATGTCGAGCTTCGGCAAGCCCCGCGCCGCAGCCTCGTCGGCCCATCTGGAGACGGCGGACGGGCGAGACATGATC
GACTTGTCTGGGCTGCAGCATCTCCCCGTCTACGAGCAAAAGTGCGCCCTCGTCAGCCGCGAACTCGATAATCAG
GGCATGGGCCGATATCAGTGGTACATCTGGTCCCTGTGCGGCTTCGGCTACTTCCTCGACCTGCTATGGGCCCAG
GCATTCGCCCTCGTCCTCAGCCCGCTCCAGCAGGAGCTGGGCTTCTCCAACAGCCAGTCTGGAAATATATCCATG
AGCTTCAATGTGGGTCTCACGACCGGGGCTTTCTTCTGGGGCTTTATGTCCGACATCATCGGTATGAATGAACCC
CCTTGGCCCTTTTGCTTGCTTTTTGACCGACGAAAATCACCGTCCCAGGACGCCGATGGGCCTTCAACTTGACCT
GCCTCCTCTCCTCCGTCTTTGGCCTATGCCTCGGCGCCGCAAACAACTACAACACCTTTCTTGTCTTGACGGCCT
TTATTGGCTTCGGCGTTGGTGGCAACATTCCCGTTGATGGCACCATCTTCCTCGAGTTTGCTCCGCAAGTTGGTC
CCCCCTCCTTTCTTGCCAATGCTTCTCCTGCTACAGAATGAAGACGCTGACTTGTTGGGCACCAGAGGAGACAGT
ATATGCTGGCTTGTCTTTCCGTTTTCCAACCCTTGGGCGTAATTGCCTGCAGCGCCTTCGCCTTCGCCTTTATAC
CCACGCATTCTTGCTCGCCCAACTTCTCCGAACCGAATCCGCTGCCGTCGTGTCACAATGTCTCGACGCCCGGAA
CTCCATGCTGCTCGCGGGAGGCCAACATGGGCTGGCGATATCTGCTCTACACGCTGGGTTCCCTGACTCTCGGCG
TCTTCATCCTACGAACCCTGATCTTCAAGTGTCGCGAGACGCCGAGATTTCTCATTTATCGAGGCCAGGACGCCA
GGGCGATGCAAACGCTGGAATACGTGGCCAAGATTAACCGGAAAAAGTGCCAGATCTCTCTACAGCTACTAGACT
CTCTGCAGAATGAGTACGACTTGAAGCAGGCTCGGGAACAATCGAGCCCACTCAGCCCGTTGAGCCCGCTGAGCC
CGCTGAGCCCGACCGAGAACCGGACGCAATTCATACCAAAGACCAAAACGGCAAAGTTTGGCCGCGAGTTGGCCA
GGTTCAAGCTGCTTTTCGGCACCAAGCGGATGACAAGCCTGACTGTTTTGACCTGGCTCACATACATGCTCGACT
TTGGCGGGTTTAACATAGCAGGTAACCACCATCGTCAATTAGCTCGTCAAGTAATAACCCCTTGTGTTCTAACGC
GTTATAGGCTTCTACCTGCCGCGAATCCTAGCACTGAAAAACGGCCAGGAGTCGATTAGTCTGCACCACACGTAC
GCCTCCTACATCTACTGTTACGCACCGGGCATCCTCGCCGTCCTTCTCGGTGCCTATGCCAGCCAGATCCCCGCC
TTGGGTCAAAAGTGGACCATGGTGGCATCGTCGGCGTTAATGGGAACATCCATCTTCCTGCTTTCACGAGTCGAC
TCCGCCGCCAAGAGCGAGGGGTTGTTTGTGCTCGAGTACTTCTTCCAGTCCACCTTCAACGCCGTCCTCTATGCC
TGGACCCCGCAGGCGTTCCCGGCGCCGATTCGGGGCACGGCCTGTGGAGTGGCCAGTTTCTGGGGGCGACTATTC
GGAATCGTGAGTCCCTTGATTGCCCAGAACCTGTACGGGCGAGCATCCGGGAACCGCGGCGACGTGGACAGTGTT
CTGTATCTAGCCGGAGGGGTTACTATGGGCTGTGTCTTGACTACGGCTCTGTTGCCCAGGACTGTGGCCGAGGAT
GAGATGCAGGAGTCAACCGATTCCAGTTACGAGCCGATAGCCAGTCCACGGGCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail