Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3391
Gene name
Locationscaffold_27:18734..20666
Strand+
Gene length (bp)1932
Transcript length (bp)1737
Coding sequence length (bp)1734
Protein length (aa) 578

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 4.3E-23 65 395
PF00083 Sugar_tr Sugar (and other) transporter 1.2E-19 84 290

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9C101|YKT8_SCHPO Uncharacterized MFS-type transporter PB1E7.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB1E7.08c PE=1 SV=1 7 518 4.0E-70
sp|P30638|SVOP_CAEEL Putative transporter svop-1 OS=Caenorhabditis elegans GN=svop-1 PE=3 SV=5 38 519 7.0E-20
sp|Q9JIS5|SV2A_MOUSE Synaptic vesicle glycoprotein 2A OS=Mus musculus GN=Sv2a PE=1 SV=1 5 295 1.0E-16
sp|Q4R4X3|SV2A_MACFA Synaptic vesicle glycoprotein 2A OS=Macaca fascicularis GN=SV2A PE=2 SV=1 5 295 1.0E-16
sp|Q7L0J3|SV2A_HUMAN Synaptic vesicle glycoprotein 2A OS=Homo sapiens GN=SV2A PE=1 SV=1 5 295 1.0E-16
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9C101|YKT8_SCHPO Uncharacterized MFS-type transporter PB1E7.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB1E7.08c PE=1 SV=1 7 518 4.0E-70
sp|P30638|SVOP_CAEEL Putative transporter svop-1 OS=Caenorhabditis elegans GN=svop-1 PE=3 SV=5 38 519 7.0E-20
sp|Q9JIS5|SV2A_MOUSE Synaptic vesicle glycoprotein 2A OS=Mus musculus GN=Sv2a PE=1 SV=1 5 295 1.0E-16
sp|Q4R4X3|SV2A_MACFA Synaptic vesicle glycoprotein 2A OS=Macaca fascicularis GN=SV2A PE=2 SV=1 5 295 1.0E-16
sp|Q7L0J3|SV2A_HUMAN Synaptic vesicle glycoprotein 2A OS=Homo sapiens GN=SV2A PE=1 SV=1 5 295 1.0E-16
sp|Q02563|SV2A_RAT Synaptic vesicle glycoprotein 2A OS=Rattus norvegicus GN=Sv2a PE=1 SV=2 5 295 1.0E-16
sp|Q29397|SV2A_BOVIN Synaptic vesicle glycoprotein 2A OS=Bos taurus GN=SV2A PE=2 SV=1 51 295 2.0E-16
sp|Q5R4L9|SV2A_PONAB Synaptic vesicle glycoprotein 2A OS=Pongo abelii GN=SV2A PE=2 SV=1 38 295 7.0E-16
sp|Q69ZS6|SV2C_MOUSE Synaptic vesicle glycoprotein 2C OS=Mus musculus GN=Sv2c PE=1 SV=2 3 295 3.0E-15
sp|Q940M4|OCT7_ARATH Organic cation/carnitine transporter 7 OS=Arabidopsis thaliana GN=OCT7 PE=2 SV=1 43 572 6.0E-15
sp|Q9Z2I6|SV2C_RAT Synaptic vesicle glycoprotein 2C OS=Rattus norvegicus GN=Sv2c PE=1 SV=1 3 295 8.0E-15
sp|Q496J9|SV2C_HUMAN Synaptic vesicle glycoprotein 2C OS=Homo sapiens GN=SV2C PE=1 SV=1 3 295 1.0E-14
sp|Q2XWK0|SVOP_XENLA Synaptic vesicle 2-related protein OS=Xenopus laevis GN=svop PE=2 SV=1 42 293 8.0E-14
sp|Q1JP63|SVOP_BOVIN Synaptic vesicle 2-related protein OS=Bos taurus GN=SVOP PE=2 SV=1 42 293 8.0E-13
sp|Q8N4V2|SVOP_HUMAN Synaptic vesicle 2-related protein OS=Homo sapiens GN=SVOP PE=2 SV=1 42 293 8.0E-13
sp|Q5R5T8|SVOP_PONAB Synaptic vesicle 2-related protein OS=Pongo abelii GN=SVOP PE=2 SV=1 42 293 9.0E-13
sp|Q7L1I2|SV2B_HUMAN Synaptic vesicle glycoprotein 2B OS=Homo sapiens GN=SV2B PE=1 SV=1 31 295 3.0E-12
sp|Q8BG39|SV2B_MOUSE Synaptic vesicle glycoprotein 2B OS=Mus musculus GN=Sv2b PE=1 SV=1 47 295 4.0E-12
sp|Q63564|SV2B_RAT Synaptic vesicle glycoprotein 2B OS=Rattus norvegicus GN=Sv2b PE=1 SV=1 19 295 2.0E-11
sp|Q8BFT9|SVOP_MOUSE Synaptic vesicle 2-related protein OS=Mus musculus GN=Svop PE=1 SV=1 42 293 5.0E-11
sp|Q9Z2I7|SVOP_RAT Synaptic vesicle 2-related protein OS=Rattus norvegicus GN=Svop PE=1 SV=1 42 293 9.0E-11
sp|O34691|NAIP_BACSU Putative niacin/nicotinamide transporter NaiP OS=Bacillus subtilis (strain 168) GN=naiP PE=1 SV=1 62 207 3.0E-10
sp|Q43975|PCAK_ACIAD 4-hydroxybenzoate transporter PcaK OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=pcaK PE=1 SV=3 38 395 5.0E-10
sp|P37514|YYAJ_BACSU Putative metabolite transport protein YyaJ OS=Bacillus subtilis (strain 168) GN=yyaJ PE=3 SV=2 44 548 5.0E-10
sp|Q51955|PCAK_PSEPU 4-hydroxybenzoate transporter PcaK OS=Pseudomonas putida GN=pcaK PE=1 SV=1 43 183 3.0E-09
sp|P25297|PHO84_YEAST Inorganic phosphate transporter PHO84 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHO84 PE=1 SV=2 1 572 2.0E-07
sp|Q9I6Q3|PCAK_PSEAE 4-hydroxybenzoate transporter PcaK OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pcaK PE=3 SV=1 47 206 3.0E-07
sp|Q94DB8|PT111_ORYSJ Inorganic phosphate transporter 1-11 OS=Oryza sativa subsp. japonica GN=PHT1-11 PE=2 SV=1 24 309 3.0E-07
sp|Q8H6G8|PHT18_ORYSJ Probable inorganic phosphate transporter 1-8 OS=Oryza sativa subsp. japonica GN=PHT1-8 PE=2 SV=1 54 302 9.0E-07
sp|Q8H6G9|PHT17_ORYSJ Probable inorganic phosphate transporter 1-7 OS=Oryza sativa subsp. japonica GN=PHT1-7 PE=2 SV=1 54 201 1.0E-06
sp|Q9ZWT3|PHT16_ARATH Probable inorganic phosphate transporter 1-6 OS=Arabidopsis thaliana GN=PHT1-6 PE=1 SV=1 105 573 2.0E-06
sp|A7MJD1|NANT_CROS8 Putative sialic acid transporter OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=nanT PE=3 SV=1 52 177 2.0E-06
sp|Q8H6H0|PHT16_ORYSJ Inorganic phosphate transporter 1-6 OS=Oryza sativa subsp. japonica GN=PHT1-6 PE=1 SV=1 37 281 2.0E-06
sp|O48639|PHT13_ARATH Probable inorganic phosphate transporter 1-3 OS=Arabidopsis thaliana GN=PHT1-3 PE=2 SV=1 43 320 3.0E-06
sp|Q96303|PHT14_ARATH Inorganic phosphate transporter 1-4 OS=Arabidopsis thaliana GN=PHT1-4 PE=1 SV=1 47 310 5.0E-06
sp|Q5PLF0|NANT_SALPA Putative sialic acid transporter OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=nanT PE=3 SV=1 52 178 5.0E-06
sp|B5BGP4|NANT_SALPK Putative sialic acid transporter OS=Salmonella paratyphi A (strain AKU_12601) GN=nanT PE=3 SV=1 52 178 5.0E-06
sp|A9MNY7|NANT_SALAR Putative sialic acid transporter OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=nanT PE=3 SV=1 52 178 5.0E-06
sp|Q9SYQ1|PHT18_ARATH Probable inorganic phosphate transporter 1-8 OS=Arabidopsis thaliana GN=PHT1-8 PE=2 SV=2 45 203 5.0E-06
sp|A9N832|NANT_SALPB Putative sialic acid transporter OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=nanT PE=3 SV=1 52 178 6.0E-06
sp|Q9S735|PHT19_ARATH Probable inorganic phosphate transporter 1-9 OS=Arabidopsis thaliana GN=PHT1-9 PE=2 SV=1 54 294 6.0E-06
sp|B4TWI9|NANT_SALSV Putative sialic acid transporter OS=Salmonella schwarzengrund (strain CVM19633) GN=nanT PE=3 SV=1 52 178 6.0E-06
sp|Q57JD0|NANT_SALCH Putative sialic acid transporter OS=Salmonella choleraesuis (strain SC-B67) GN=nanT PE=3 SV=1 52 178 6.0E-06
sp|C0PZN3|NANT_SALPC Putative sialic acid transporter OS=Salmonella paratyphi C (strain RKS4594) GN=nanT PE=3 SV=1 52 178 6.0E-06
sp|B5F7J8|NANT_SALA4 Putative sialic acid transporter OS=Salmonella agona (strain SL483) GN=nanT PE=3 SV=1 52 178 6.0E-06
sp|B5FIR7|NANT_SALDC Putative sialic acid transporter OS=Salmonella dublin (strain CT_02021853) GN=nanT PE=3 SV=1 52 178 6.0E-06
sp|B5R0L1|NANT_SALEP Putative sialic acid transporter OS=Salmonella enteritidis PT4 (strain P125109) GN=nanT PE=3 SV=1 52 178 6.0E-06
sp|B5RET6|NANT_SALG2 Putative sialic acid transporter OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=nanT PE=3 SV=1 52 178 6.0E-06
sp|B4TJR2|NANT_SALHS Putative sialic acid transporter OS=Salmonella heidelberg (strain SL476) GN=nanT PE=3 SV=1 52 178 6.0E-06
sp|B4T749|NANT_SALNS Putative sialic acid transporter OS=Salmonella newport (strain SL254) GN=nanT PE=3 SV=1 52 178 6.0E-06
sp|P0A2G6|NANT_SALTI Putative sialic acid transporter OS=Salmonella typhi GN=nanT PE=3 SV=1 52 178 6.0E-06
sp|P0A2G5|NANT_SALTY Putative sialic acid transporter OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=nanT PE=3 SV=1 52 178 6.0E-06
sp|Q494P0|PHT17_ARATH Probable inorganic phosphate transporter 1-7 OS=Arabidopsis thaliana GN=PHT1-7 PE=2 SV=2 47 313 7.0E-06
sp|Q7XDZ7|PHT13_ORYSJ Probable inorganic phosphate transporter 1-3 OS=Oryza sativa subsp. japonica GN=PHT1-3 PE=2 SV=1 54 246 7.0E-06
sp|Q8H6H4|PHT11_ORYSJ Inorganic phosphate transporter 1-1 OS=Oryza sativa subsp. japonica GN=PHT1-1 PE=2 SV=1 54 246 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

Domain # Start End Length
1 58 80 22
2 95 117 22
3 124 146 22
4 150 172 22
5 185 207 22
6 242 264 22
7 369 391 22
8 411 433 22
9 534 553 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3391
MSSFGKPRAAASSAHLETADGRDMIDLSGLQHLPVYEQKCALVSRELDNQGMGRYQWYIWSLCGFGYFLDLLWAQ
AFALVLSPLQQELGFSNSQSGNISMSFNVGLTTGAFFWGFMSDIIGRRWAFNLTCLLSSVFGLCLGAANNYNTFL
VLTAFIGFGVGGNIPVDGTIFLEFAPQRRQYMLACLSVFQPLGVIACSAFAFAFIPTHSCSPNFSEPNPLPSCHN
VSTPGTPCCSREANMGWRYLLYTLGSLTLGVFILRTLIFKCRETPRFLIYRGQDARAMQTLEYVAKINRKKCQIS
LQLLDSLQNEYDLKQAREQSSPLSPLSPLSPLSPTENRTQFIPKTKTAKFGRELARFKLLFGTKRMTSLTVLTWL
TYMLDFGGFNIAGFYLPRILALKNGQESISLHHTYASYIYCYAPGILAVLLGAYASQIPALGQKWTMVASSALMG
TSIFLLSRVDSAAKSEGLFVLEYFFQSTFNAVLYAWTPQAFPAPIRGTACGVASFWGRLFGIVSPLIAQNLYGRA
SGNRGDVDSVLYLAGGVTMGCVLTTALLPRTVAEDEMQESTDSSYEPIASPRA
Coding >Ophio5|3391
ATGTCGAGCTTCGGCAAGCCCCGCGCCGCAGCCTCGTCGGCCCATCTGGAGACGGCGGACGGGCGAGACATGATC
GACTTGTCTGGGCTGCAGCATCTCCCCGTCTACGAGCAAAAGTGCGCCCTCGTCAGCCGCGAACTCGATAATCAG
GGCATGGGCCGATATCAGTGGTACATCTGGTCCCTGTGCGGCTTCGGCTACTTCCTCGACCTGCTATGGGCCCAG
GCATTCGCCCTCGTCCTCAGCCCGCTCCAGCAGGAGCTGGGCTTCTCCAACAGCCAGTCTGGAAATATATCCATG
AGCTTCAATGTGGGTCTCACGACCGGGGCTTTCTTCTGGGGCTTTATGTCCGACATCATCGGACGCCGATGGGCC
TTCAACTTGACCTGCCTCCTCTCCTCCGTCTTTGGCCTATGCCTCGGCGCCGCAAACAACTACAACACCTTTCTT
GTCTTGACGGCCTTTATTGGCTTCGGCGTTGGTGGCAACATTCCCGTTGATGGCACCATCTTCCTCGAGTTTGCT
CCGCAAAGGAGACAGTATATGCTGGCTTGTCTTTCCGTTTTCCAACCCTTGGGCGTAATTGCCTGCAGCGCCTTC
GCCTTCGCCTTTATACCCACGCATTCTTGCTCGCCCAACTTCTCCGAACCGAATCCGCTGCCGTCGTGTCACAAT
GTCTCGACGCCCGGAACTCCATGCTGCTCGCGGGAGGCCAACATGGGCTGGCGATATCTGCTCTACACGCTGGGT
TCCCTGACTCTCGGCGTCTTCATCCTACGAACCCTGATCTTCAAGTGTCGCGAGACGCCGAGATTTCTCATTTAT
CGAGGCCAGGACGCCAGGGCGATGCAAACGCTGGAATACGTGGCCAAGATTAACCGGAAAAAGTGCCAGATCTCT
CTACAGCTACTAGACTCTCTGCAGAATGAGTACGACTTGAAGCAGGCTCGGGAACAATCGAGCCCACTCAGCCCG
TTGAGCCCGCTGAGCCCGCTGAGCCCGACCGAGAACCGGACGCAATTCATACCAAAGACCAAAACGGCAAAGTTT
GGCCGCGAGTTGGCCAGGTTCAAGCTGCTTTTCGGCACCAAGCGGATGACAAGCCTGACTGTTTTGACCTGGCTC
ACATACATGCTCGACTTTGGCGGGTTTAACATAGCAGGCTTCTACCTGCCGCGAATCCTAGCACTGAAAAACGGC
CAGGAGTCGATTAGTCTGCACCACACGTACGCCTCCTACATCTACTGTTACGCACCGGGCATCCTCGCCGTCCTT
CTCGGTGCCTATGCCAGCCAGATCCCCGCCTTGGGTCAAAAGTGGACCATGGTGGCATCGTCGGCGTTAATGGGA
ACATCCATCTTCCTGCTTTCACGAGTCGACTCCGCCGCCAAGAGCGAGGGGTTGTTTGTGCTCGAGTACTTCTTC
CAGTCCACCTTCAACGCCGTCCTCTATGCCTGGACCCCGCAGGCGTTCCCGGCGCCGATTCGGGGCACGGCCTGT
GGAGTGGCCAGTTTCTGGGGGCGACTATTCGGAATCGTGAGTCCCTTGATTGCCCAGAACCTGTACGGGCGAGCA
TCCGGGAACCGCGGCGACGTGGACAGTGTTCTGTATCTAGCCGGAGGGGTTACTATGGGCTGTGTCTTGACTACG
GCTCTGTTGCCCAGGACTGTGGCCGAGGATGAGATGCAGGAGTCAACCGATTCCAGTTACGAGCCGATAGCCAGT
CCACGGGCA
Transcript >Ophio5|3391
ATGTCGAGCTTCGGCAAGCCCCGCGCCGCAGCCTCGTCGGCCCATCTGGAGACGGCGGACGGGCGAGACATGATC
GACTTGTCTGGGCTGCAGCATCTCCCCGTCTACGAGCAAAAGTGCGCCCTCGTCAGCCGCGAACTCGATAATCAG
GGCATGGGCCGATATCAGTGGTACATCTGGTCCCTGTGCGGCTTCGGCTACTTCCTCGACCTGCTATGGGCCCAG
GCATTCGCCCTCGTCCTCAGCCCGCTCCAGCAGGAGCTGGGCTTCTCCAACAGCCAGTCTGGAAATATATCCATG
AGCTTCAATGTGGGTCTCACGACCGGGGCTTTCTTCTGGGGCTTTATGTCCGACATCATCGGACGCCGATGGGCC
TTCAACTTGACCTGCCTCCTCTCCTCCGTCTTTGGCCTATGCCTCGGCGCCGCAAACAACTACAACACCTTTCTT
GTCTTGACGGCCTTTATTGGCTTCGGCGTTGGTGGCAACATTCCCGTTGATGGCACCATCTTCCTCGAGTTTGCT
CCGCAAAGGAGACAGTATATGCTGGCTTGTCTTTCCGTTTTCCAACCCTTGGGCGTAATTGCCTGCAGCGCCTTC
GCCTTCGCCTTTATACCCACGCATTCTTGCTCGCCCAACTTCTCCGAACCGAATCCGCTGCCGTCGTGTCACAAT
GTCTCGACGCCCGGAACTCCATGCTGCTCGCGGGAGGCCAACATGGGCTGGCGATATCTGCTCTACACGCTGGGT
TCCCTGACTCTCGGCGTCTTCATCCTACGAACCCTGATCTTCAAGTGTCGCGAGACGCCGAGATTTCTCATTTAT
CGAGGCCAGGACGCCAGGGCGATGCAAACGCTGGAATACGTGGCCAAGATTAACCGGAAAAAGTGCCAGATCTCT
CTACAGCTACTAGACTCTCTGCAGAATGAGTACGACTTGAAGCAGGCTCGGGAACAATCGAGCCCACTCAGCCCG
TTGAGCCCGCTGAGCCCGCTGAGCCCGACCGAGAACCGGACGCAATTCATACCAAAGACCAAAACGGCAAAGTTT
GGCCGCGAGTTGGCCAGGTTCAAGCTGCTTTTCGGCACCAAGCGGATGACAAGCCTGACTGTTTTGACCTGGCTC
ACATACATGCTCGACTTTGGCGGGTTTAACATAGCAGGCTTCTACCTGCCGCGAATCCTAGCACTGAAAAACGGC
CAGGAGTCGATTAGTCTGCACCACACGTACGCCTCCTACATCTACTGTTACGCACCGGGCATCCTCGCCGTCCTT
CTCGGTGCCTATGCCAGCCAGATCCCCGCCTTGGGTCAAAAGTGGACCATGGTGGCATCGTCGGCGTTAATGGGA
ACATCCATCTTCCTGCTTTCACGAGTCGACTCCGCCGCCAAGAGCGAGGGGTTGTTTGTGCTCGAGTACTTCTTC
CAGTCCACCTTCAACGCCGTCCTCTATGCCTGGACCCCGCAGGCGTTCCCGGCGCCGATTCGGGGCACGGCCTGT
GGAGTGGCCAGTTTCTGGGGGCGACTATTCGGAATCGTGAGTCCCTTGATTGCCCAGAACCTGTACGGGCGAGCA
TCCGGGAACCGCGGCGACGTGGACAGTGTTCTGTATCTAGCCGGAGGGGTTACTATGGGCTGTGTCTTGACTACG
GCTCTGTTGCCCAGGACTGTGGCCGAGGATGAGATGCAGGAGTCAACCGATTCCAGTTACGAGCCGATAGCCAGT
CCACGGGCATAG
Gene >Ophio5|3391
ATGTCGAGCTTCGGCAAGCCCCGCGCCGCAGCCTCGTCGGCCCATCTGGAGACGGCGGACGGGCGAGACATGATC
GACTTGTCTGGGCTGCAGCATCTCCCCGTCTACGAGCAAAAGTGCGCCCTCGTCAGCCGCGAACTCGATAATCAG
GGCATGGGCCGATATCAGTGGTACATCTGGTCCCTGTGCGGCTTCGGCTACTTCCTCGACCTGCTATGGGCCCAG
GCATTCGCCCTCGTCCTCAGCCCGCTCCAGCAGGAGCTGGGCTTCTCCAACAGCCAGTCTGGAAATATATCCATG
AGCTTCAATGTGGGTCTCACGACCGGGGCTTTCTTCTGGGGCTTTATGTCCGACATCATCGGTATGAATGAACCC
CCTTGGCCCTTTTGCTTGCTTTTTGACCGACGAAAATCACCGTCCCAGGACGCCGATGGGCCTTCAACTTGACCT
GCCTCCTCTCCTCCGTCTTTGGCCTATGCCTCGGCGCCGCAAACAACTACAACACCTTTCTTGTCTTGACGGCCT
TTATTGGCTTCGGCGTTGGTGGCAACATTCCCGTTGATGGCACCATCTTCCTCGAGTTTGCTCCGCAAGTTGGTC
CCCCCTCCTTTCTTGCCAATGCTTCTCCTGCTACAGAATGAAGACGCTGACTTGTTGGGCACCAGAGGAGACAGT
ATATGCTGGCTTGTCTTTCCGTTTTCCAACCCTTGGGCGTAATTGCCTGCAGCGCCTTCGCCTTCGCCTTTATAC
CCACGCATTCTTGCTCGCCCAACTTCTCCGAACCGAATCCGCTGCCGTCGTGTCACAATGTCTCGACGCCCGGAA
CTCCATGCTGCTCGCGGGAGGCCAACATGGGCTGGCGATATCTGCTCTACACGCTGGGTTCCCTGACTCTCGGCG
TCTTCATCCTACGAACCCTGATCTTCAAGTGTCGCGAGACGCCGAGATTTCTCATTTATCGAGGCCAGGACGCCA
GGGCGATGCAAACGCTGGAATACGTGGCCAAGATTAACCGGAAAAAGTGCCAGATCTCTCTACAGCTACTAGACT
CTCTGCAGAATGAGTACGACTTGAAGCAGGCTCGGGAACAATCGAGCCCACTCAGCCCGTTGAGCCCGCTGAGCC
CGCTGAGCCCGACCGAGAACCGGACGCAATTCATACCAAAGACCAAAACGGCAAAGTTTGGCCGCGAGTTGGCCA
GGTTCAAGCTGCTTTTCGGCACCAAGCGGATGACAAGCCTGACTGTTTTGACCTGGCTCACATACATGCTCGACT
TTGGCGGGTTTAACATAGCAGGTAACCACCATCGTCAATTAGCTCGTCAAGTAATAACCCCTTGTGTTCTAACGC
GTTATAGGCTTCTACCTGCCGCGAATCCTAGCACTGAAAAACGGCCAGGAGTCGATTAGTCTGCACCACACGTAC
GCCTCCTACATCTACTGTTACGCACCGGGCATCCTCGCCGTCCTTCTCGGTGCCTATGCCAGCCAGATCCCCGCC
TTGGGTCAAAAGTGGACCATGGTGGCATCGTCGGCGTTAATGGGAACATCCATCTTCCTGCTTTCACGAGTCGAC
TCCGCCGCCAAGAGCGAGGGGTTGTTTGTGCTCGAGTACTTCTTCCAGTCCACCTTCAACGCCGTCCTCTATGCC
TGGACCCCGCAGGCGTTCCCGGCGCCGATTCGGGGCACGGCCTGTGGAGTGGCCAGTTTCTGGGGGCGACTATTC
GGAATCGTGAGTCCCTTGATTGCCCAGAACCTGTACGGGCGAGCATCCGGGAACCGCGGCGACGTGGACAGTGTT
CTGTATCTAGCCGGAGGGGTTACTATGGGCTGTGTCTTGACTACGGCTCTGTTGCCCAGGACTGTGGCCGAGGAT
GAGATGCAGGAGTCAACCGATTCCAGTTACGAGCCGATAGCCAGTCCACGGGCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail