Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3386
Gene name
Locationscaffold_27:1685..3227
Strand-
Gene length (bp)1542
Transcript length (bp)1542
Coding sequence length (bp)1539
Protein length (aa) 513

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13520 AA_permease_2 Amino acid permease 2.2E-55 41 478
PF00324 AA_permease Amino acid permease 1.1E-22 33 485

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P19807|HNM1_YEAST Choline transport protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HNM1 PE=1 SV=1 11 497 1.0E-64
sp|Q9US40|YFZ1_SCHPO Uncharacterized amino-acid permease C1039.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1039.01 PE=3 SV=1 8 503 3.0E-41
sp|O74537|YCQ4_SCHPO Uncharacterized amino-acid permease C74.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC74.04 PE=3 SV=1 3 502 4.0E-38
sp|Q09887|YC9D_SCHPO Uncharacterized amino-acid permease C584.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC584.13 PE=3 SV=1 14 504 5.0E-35
sp|P53744|BIO5_YEAST 7-keto 8-aminopelargonic acid transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BIO5 PE=1 SV=1 11 478 9.0E-35
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P19807|HNM1_YEAST Choline transport protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HNM1 PE=1 SV=1 11 497 1.0E-64
sp|Q9US40|YFZ1_SCHPO Uncharacterized amino-acid permease C1039.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1039.01 PE=3 SV=1 8 503 3.0E-41
sp|O74537|YCQ4_SCHPO Uncharacterized amino-acid permease C74.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC74.04 PE=3 SV=1 3 502 4.0E-38
sp|Q09887|YC9D_SCHPO Uncharacterized amino-acid permease C584.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC584.13 PE=3 SV=1 14 504 5.0E-35
sp|P53744|BIO5_YEAST 7-keto 8-aminopelargonic acid transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BIO5 PE=1 SV=1 11 478 9.0E-35
sp|O60113|YG64_SCHPO Uncharacterized amino-acid permease C15C4.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC15C4.04c PE=3 SV=1 59 512 3.0E-31
sp|Q9ZU50|BAT1_ARATH Amino-acid permease BAT1 OS=Arabidopsis thaliana GN=BAT1 PE=2 SV=2 9 499 2.0E-29
sp|P36029|TPO5_YEAST Polyamine transporter TPO5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO5 PE=1 SV=1 12 499 2.0E-27
sp|O59942|AAP2_NEUCR Amino-acid permease 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=aap-2 PE=2 SV=2 17 499 9.0E-27
sp|P32837|UGA4_YEAST GABA-specific permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UGA4 PE=1 SV=1 23 476 2.0E-26
sp|B9EXZ6|BAT1_ORYSJ Amino-acid permease BAT1 homolog OS=Oryza sativa subsp. japonica GN=BAT1 PE=2 SV=1 15 499 1.0E-25
sp|O74248|GPT1_CANAX Putative polyamine transporter OS=Candida albicans GN=GPT1 PE=3 SV=1 3 500 1.0E-22
sp|Q10087|YAO8_SCHPO Uncharacterized amino-acid permease C11D3.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11D3.08c PE=3 SV=1 3 499 4.0E-21
sp|Q9UT18|THI9_SCHPO Thiamine transporter thi9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=thi9 PE=1 SV=1 12 483 2.0E-19
sp|Q9C0Z0|YKM2_SCHPO Uncharacterized amino-acid permease PB24D3.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB24D3.02c PE=3 SV=1 23 502 8.0E-18
sp|O59813|YCT3_SCHPO Uncharacterized amino-acid permease C794.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.03 PE=2 SV=1 51 488 2.0E-15
sp|Q8W4K3|CAAT4_ARATH Cationic amino acid transporter 4, vacuolar OS=Arabidopsis thaliana GN=CAT4 PE=2 SV=1 3 417 6.0E-12
sp|Q8GYB4|CAAT3_ARATH Cationic amino acid transporter 3, mitochondrial OS=Arabidopsis thaliana GN=CAT3 PE=2 SV=1 6 398 1.0E-10
sp|Q9ASS7|CAAT2_ARATH Cationic amino acid transporter 2, vacuolar OS=Arabidopsis thaliana GN=CAT2 PE=2 SV=1 6 407 7.0E-09
sp|Q6DCE8|CTR2_XENLA Cationic amino acid transporter 2 OS=Xenopus laevis GN=slc7a2 PE=2 SV=1 65 417 7.0E-08
sp|Q92536|YLAT2_HUMAN Y+L amino acid transporter 2 OS=Homo sapiens GN=SLC7A6 PE=1 SV=3 4 278 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0016020 membrane Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0110165 cellular anatomical entity No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 50 0.5

Transmembrane Domains

Domain # Start End Length
1 34 56 22
2 71 93 22
3 114 136 22
4 156 178 22
5 187 209 22
6 229 251 22
7 272 294 22
8 319 341 22
9 369 391 22
10 401 423 22
11 436 458 22
12 473 490 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 0.04 0.0 0.23
CcL In ants, during behavior modification 0.04 0.0 0.23
CcD In ants, recently dead 0.00 0.0 0.00

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 1.0 no
SC16a CcD 1.0 no
CcL CcD 1.0 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3386
MYNPTVKQPQVDDSHARPVNASGHAQELPLRFSLLSLAGIGLLVGNVWPAIGGSLAVAISNGGPPGVLYEFIAVS
FCYVAVAVSIAELASAVPSSAGVYHWASVTPGGPAGRPIGFLAGWWNYLAWVLGAASMTSILGSSVIQMHATTHR
DFKVETWHVLVVYLVCTWTACLAVCIGSKAMPTLNKMGGYAIVVFFVITVVVVVVMPSLPGHDGHASSESVWMRW
TTSISYPPAFVFLSGMLNGAYSVGAVDAITHLAEEIPNPERNVPLALALQVSIGFVTGLCYLIAILYSIHDLNAL
RDSSYPIVDIYGQATGSQAGAAGLLSMIVVCIGLTVLGLQITCGRTLWTLARDGASPFPARLSRMNKTLHVPVNA
TVVSAILVTVLGILYVGNTTAFNAFVGSFVLLSSSSYVACILPHLLTGRKNVPQGPFRMRGAWGYVINAISCLHM
IVWGVIYCFPSNLPTNANSLNYTGVIWGGSTIFIALFWFLRARRGYRGPRVTSGTVYMETSGL
Coding >Ophio5|3386
ATGTACAACCCGACAGTCAAGCAACCCCAAGTCGACGACTCACACGCTCGCCCCGTCAACGCATCGGGCCACGCC
CAAGAACTTCCCCTTCGCTTCAGCCTTCTCTCGCTAGCTGGTATCGGTCTCCTCGTCGGCAACGTCTGGCCTGCC
ATCGGAGGCTCGCTGGCAGTGGCCATCTCCAACGGCGGGCCTCCAGGCGTGCTGTACGAGTTCATCGCCGTGTCC
TTTTGCTATGTCGCCGTGGCCGTCAGCATCGCCGAACTGGCCAGTGCCGTGCCATCCTCGGCCGGCGTCTATCAC
TGGGCGTCGGTCACGCCCGGAGGTCCCGCCGGCCGGCCTATCGGATTCCTGGCCGGTTGGTGGAACTATCTCGCC
TGGGTGCTGGGCGCGGCGAGCATGACGTCCATTCTGGGCAGTTCCGTCATTCAGATGCACGCGACCACGCATCGT
GACTTCAAGGTTGAGACCTGGCATGTCTTGGTCGTCTATCTTGTCTGCACTTGGACGGCATGCCTGGCCGTCTGT
ATCGGTAGCAAGGCAATGCCCACGCTCAACAAGATGGGTGGCTACGCCATCGTCGTCTTCTTCGTCATCACCGTA
GTGGTCGTGGTCGTGATGCCCTCACTTCCGGGCCACGACGGACACGCGTCTTCCGAGTCCGTCTGGATGCGGTGG
ACGACGTCGATTTCCTATCCCCCCGCCTTCGTCTTCTTGTCTGGCATGCTCAACGGTGCTTATAGCGTCGGTGCT
GTCGATGCGATTACTCACCTTGCTGAGGAGATCCCCAACCCGGAACGCAACGTGCCCCTGGCCCTGGCTCTACAG
GTCTCCATCGGTTTCGTGACCGGCCTCTGCTATCTGATTGCTATATTGTATTCCATCCACGACTTGAACGCCCTG
CGAGACTCGTCGTATCCCATTGTCGATATCTACGGCCAAGCCACTGGCTCTCAGGCAGGCGCAGCGGGCTTGCTG
TCCATGATCGTCGTCTGCATAGGGCTCACTGTCCTCGGCCTTCAGATAACTTGCGGACGAACGTTGTGGACACTG
GCCCGCGACGGTGCCTCGCCCTTCCCAGCCAGACTCTCCCGGATGAACAAGACGCTTCACGTCCCGGTCAACGCC
ACCGTCGTCTCCGCCATCCTGGTGACCGTGCTTGGCATTCTCTACGTGGGAAACACGACTGCTTTCAACGCCTTT
GTTGGCAGCTTCGTTCTTCTCTCTAGCAGCTCGTACGTGGCCTGTATCTTGCCCCATCTTCTGACGGGTCGCAAG
AATGTCCCCCAGGGGCCATTCAGGATGCGCGGAGCATGGGGGTACGTGATCAACGCGATTTCGTGTTTGCATATG
ATAGTCTGGGGCGTCATTTACTGTTTCCCGTCGAATCTTCCGACGAATGCAAATAGCCTGAACTACACCGGTGTA
ATCTGGGGCGGCTCGACCATCTTCATCGCTTTGTTTTGGTTCTTGAGGGCGAGAAGAGGATACAGAGGTCCAAGG
GTGACGAGCGGGACCGTCTACATGGAAACTTCAGGGTTA
Transcript >Ophio5|3386
ATGTACAACCCGACAGTCAAGCAACCCCAAGTCGACGACTCACACGCTCGCCCCGTCAACGCATCGGGCCACGCC
CAAGAACTTCCCCTTCGCTTCAGCCTTCTCTCGCTAGCTGGTATCGGTCTCCTCGTCGGCAACGTCTGGCCTGCC
ATCGGAGGCTCGCTGGCAGTGGCCATCTCCAACGGCGGGCCTCCAGGCGTGCTGTACGAGTTCATCGCCGTGTCC
TTTTGCTATGTCGCCGTGGCCGTCAGCATCGCCGAACTGGCCAGTGCCGTGCCATCCTCGGCCGGCGTCTATCAC
TGGGCGTCGGTCACGCCCGGAGGTCCCGCCGGCCGGCCTATCGGATTCCTGGCCGGTTGGTGGAACTATCTCGCC
TGGGTGCTGGGCGCGGCGAGCATGACGTCCATTCTGGGCAGTTCCGTCATTCAGATGCACGCGACCACGCATCGT
GACTTCAAGGTTGAGACCTGGCATGTCTTGGTCGTCTATCTTGTCTGCACTTGGACGGCATGCCTGGCCGTCTGT
ATCGGTAGCAAGGCAATGCCCACGCTCAACAAGATGGGTGGCTACGCCATCGTCGTCTTCTTCGTCATCACCGTA
GTGGTCGTGGTCGTGATGCCCTCACTTCCGGGCCACGACGGACACGCGTCTTCCGAGTCCGTCTGGATGCGGTGG
ACGACGTCGATTTCCTATCCCCCCGCCTTCGTCTTCTTGTCTGGCATGCTCAACGGTGCTTATAGCGTCGGTGCT
GTCGATGCGATTACTCACCTTGCTGAGGAGATCCCCAACCCGGAACGCAACGTGCCCCTGGCCCTGGCTCTACAG
GTCTCCATCGGTTTCGTGACCGGCCTCTGCTATCTGATTGCTATATTGTATTCCATCCACGACTTGAACGCCCTG
CGAGACTCGTCGTATCCCATTGTCGATATCTACGGCCAAGCCACTGGCTCTCAGGCAGGCGCAGCGGGCTTGCTG
TCCATGATCGTCGTCTGCATAGGGCTCACTGTCCTCGGCCTTCAGATAACTTGCGGACGAACGTTGTGGACACTG
GCCCGCGACGGTGCCTCGCCCTTCCCAGCCAGACTCTCCCGGATGAACAAGACGCTTCACGTCCCGGTCAACGCC
ACCGTCGTCTCCGCCATCCTGGTGACCGTGCTTGGCATTCTCTACGTGGGAAACACGACTGCTTTCAACGCCTTT
GTTGGCAGCTTCGTTCTTCTCTCTAGCAGCTCGTACGTGGCCTGTATCTTGCCCCATCTTCTGACGGGTCGCAAG
AATGTCCCCCAGGGGCCATTCAGGATGCGCGGAGCATGGGGGTACGTGATCAACGCGATTTCGTGTTTGCATATG
ATAGTCTGGGGCGTCATTTACTGTTTCCCGTCGAATCTTCCGACGAATGCAAATAGCCTGAACTACACCGGTGTA
ATCTGGGGCGGCTCGACCATCTTCATCGCTTTGTTTTGGTTCTTGAGGGCGAGAAGAGGATACAGAGGTCCAAGG
GTGACGAGCGGGACCGTCTACATGGAAACTTCAGGGTTATAA
Gene >Ophio5|3386
ATGTACAACCCGACAGTCAAGCAACCCCAAGTCGACGACTCACACGCTCGCCCCGTCAACGCATCGGGCCACGCC
CAAGAACTTCCCCTTCGCTTCAGCCTTCTCTCGCTAGCTGGTATCGGTCTCCTCGTCGGCAACGTCTGGCCTGCC
ATCGGAGGCTCGCTGGCAGTGGCCATCTCCAACGGCGGGCCTCCAGGCGTGCTGTACGAGTTCATCGCCGTGTCC
TTTTGCTATGTCGCCGTGGCCGTCAGCATCGCCGAACTGGCCAGTGCCGTGCCATCCTCGGCCGGCGTCTATCAC
TGGGCGTCGGTCACGCCCGGAGGTCCCGCCGGCCGGCCTATCGGATTCCTGGCCGGTTGGTGGAACTATCTCGCC
TGGGTGCTGGGCGCGGCGAGCATGACGTCCATTCTGGGCAGTTCCGTCATTCAGATGCACGCGACCACGCATCGT
GACTTCAAGGTTGAGACCTGGCATGTCTTGGTCGTCTATCTTGTCTGCACTTGGACGGCATGCCTGGCCGTCTGT
ATCGGTAGCAAGGCAATGCCCACGCTCAACAAGATGGGTGGCTACGCCATCGTCGTCTTCTTCGTCATCACCGTA
GTGGTCGTGGTCGTGATGCCCTCACTTCCGGGCCACGACGGACACGCGTCTTCCGAGTCCGTCTGGATGCGGTGG
ACGACGTCGATTTCCTATCCCCCCGCCTTCGTCTTCTTGTCTGGCATGCTCAACGGTGCTTATAGCGTCGGTGCT
GTCGATGCGATTACTCACCTTGCTGAGGAGATCCCCAACCCGGAACGCAACGTGCCCCTGGCCCTGGCTCTACAG
GTCTCCATCGGTTTCGTGACCGGCCTCTGCTATCTGATTGCTATATTGTATTCCATCCACGACTTGAACGCCCTG
CGAGACTCGTCGTATCCCATTGTCGATATCTACGGCCAAGCCACTGGCTCTCAGGCAGGCGCAGCGGGCTTGCTG
TCCATGATCGTCGTCTGCATAGGGCTCACTGTCCTCGGCCTTCAGATAACTTGCGGACGAACGTTGTGGACACTG
GCCCGCGACGGTGCCTCGCCCTTCCCAGCCAGACTCTCCCGGATGAACAAGACGCTTCACGTCCCGGTCAACGCC
ACCGTCGTCTCCGCCATCCTGGTGACCGTGCTTGGCATTCTCTACGTGGGAAACACGACTGCTTTCAACGCCTTT
GTTGGCAGCTTCGTTCTTCTCTCTAGCAGCTCGTACGTGGCCTGTATCTTGCCCCATCTTCTGACGGGTCGCAAG
AATGTCCCCCAGGGGCCATTCAGGATGCGCGGAGCATGGGGGTACGTGATCAACGCGATTTCGTGTTTGCATATG
ATAGTCTGGGGCGTCATTTACTGTTTCCCGTCGAATCTTCCGACGAATGCAAATAGCCTGAACTACACCGGTGTA
ATCTGGGGCGGCTCGACCATCTTCATCGCTTTGTTTTGGTTCTTGAGGGCGAGAAGAGGATACAGAGGTCCAAGG
GTGACGAGCGGGACCGTCTACATGGAAACTTCAGGGTTATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail